SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010753 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010753
Domain Number 1 Region: 376-568
Classification Level Classification E-value
Superfamily Glycolipid transfer protein, GLTP 3.4e-50
Family Glycolipid transfer protein, GLTP 0.0000859
Further Details:      
 
Domain Number 2 Region: 1-107
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-22
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010753   Gene: ENSGACG00000008123   Transcript: ENSGACT00000010775
Sequence length 570
Comment pep:known_by_projection group:BROADS1:groupXX:9591204:9596945:-1 gene:ENSGACG00000008123 transcript:ENSGACT00000010775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGMLHKWTNYISGWQPRWFVLDGGTLSYYDSQEDAWKGCKGSIKISVCEIQVNSSDSTR
VDLTIPGEQYFYLRAINAAERQKWLVALGSAKACLTDNRTRREKELQENTEALKTKMSEL
RLYCDLLLQQVHKIKESDELGDTAETGIDTGNIVKSTCTTFLKTLEECMQIANHTFSTDI
STQTPPGSPPVAAVKPQKIKPVNHLKQNLGEKWRDLAESSGEVIAHDNQSLDSGAEGPDE
PDRPEQHHSPSDVDATDKQSVQEEVSDPTSYTTQTAPESEHHQQPAERVEGNEADDLKGT
KREQLHEGDQSQEEHDNSKREVDAVQAQHQHDAVPDQEEAQHEGGTSGVSPEPEDTEQVE
TFFSTMSHRFSDIRLDDDNGIPTQEFLDSCYAIVPVLDKLGSTVFAPVKMDFVGNIKKIH
QKLMSDPNGYPTLQSIVLYEVQTDVARVRNSATEALLWLGRGLKFLKEFLSELHAGEQNI
QGALNNAYGKTLRQYHGWVVRGVFALALRAAPSYQGFAAALVSRQGDELKGGFASGVHRD
LGVYLPAMGEQLAILDALYLEYNLESDEVV
Download sequence
Identical sequences G3NZI0
69293.ENSGACP00000010753 ENSGACP00000010753 ENSGACP00000010753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]