SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010771 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010771
Domain Number 1 Region: 1444-1621
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-42
Family DBL homology domain (DH-domain) 0.0000343
Further Details:      
 
Domain Number 2 Region: 1631-1746
Classification Level Classification E-value
Superfamily PH domain-like 1.48e-36
Family Pleckstrin-homology domain (PH domain) 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010771   Gene: ENSGACG00000008135   Transcript: ENSGACT00000010793
Sequence length 1874
Comment pep:known_by_projection group:BROADS1:groupXVII:7244323:7257588:-1 gene:ENSGACG00000008135 transcript:ENSGACT00000010793 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QNPESLDSSIQGALSALFPPFEATAPIVLSQLFRTIEERYHGDALQCLLDFLIPSKHLLE
SVQQAACAGYSDVVFRCEGWPLCLHDKTIIQLAPVNPLLLRPGDFYLQVEPFGDQAARVV
LKSLLEEGCREVEETPVPETSYPCIFTEKWLQEINEGRQETPLSRCLLCTDQGVIKVPWE
KIAIPEFLDKPKVMPTYREPPPEPKQISVPSRFTSSTLPMGAIMVPPKDRMPGSLRPVDC
SSKLIRMDHERQTSKSRSTPLIKPVGWVSPNTWDSRNYQGVEGDYVDLVDIATGTEPVDK
QSSSHSHPQNSGLFKPVRPPPPVPLGNNVPYGRNLQYTEDPRTPCSQRRLEHEPTDQELK
CRYRDSYVAALRNPVAFERGSVELLATLEEVVLCEDPQLRANGAFEAQRDKLGSCCNNCN
KPLIKNELSQCKHCCEATPENFVSHLKDLPTSSKSENPMKESPKILKSTPGLSQSHKVQM
KLISHQSGQNTGIHSGSDGDLKPPHKVEVVKPSGKQKNKVRSLSTVSESSKGSPLLYKVN
NRSHSDICPQTITSIMQCKKADLLEQVTLKLERLNSPKQGKADCSDHFCSLFICLDLVIT
AHTASATICCSMLKGPLNIHTKQRMCSTEIIKVLHKEGSNVKHRARLQPAPTIVRCFGYI
HIITNTEGGTGNAIPHPMKGREIPSTVDGPDSKVHNSKIEKPSPAQLQLLSTSSDSNQPA
QTQESWFRDIVGMLELGIICLPGSRDRTGRAVVEVNGDKKEWTSSLVSVQSVCELLLYLH
SIPRKEVRELGMTLVINSRKKPPTLHLYKALLMAQEQALHAVHSIVTLVDKDTCPRPEKQ
PGLQMDMVTSMKALNKTVEASQLTSDLGGTFTYSHTDWLQFHQRLVAFMAELRGADSLLQ
KAINKVDCSKTMDTAQEVQQCIQEQKASMREVLEDTRLVALQREGGAALARMRREEYRFP
QSEDYRDALESVTSLYNEVEEKLHTLVMRSNESLLHLEFLFRLREMEAKICTAGMWFKAE
GEQSLKDSYTTQDPPVCTEKALLHFDVFLTKSKDKQQCALSLVRDAMAVVGTSDTSPATV
FRTLVSTFKSNVDDFMLCAEQRHNELDTLVRVHRFCEEAAALAKECFHFLEQVEQGCYPA
PTLRTLQMYEERLGGKFSTPHFQALKAETCAMGSGASGVMRVWNAALVQCQEVGQRLKEM
LKKEKDKNQIQQLTAANPQAEDREMEKEKKITEVGEDESSLTQQRTSQKEVVKIAESEGQ
RTTAACFNHHLKHDTKEESQGQELPEAAVKTEKIANFFPQCIDCHPETRHGPREHHSEAD
LRSTHSVEGGGDFPLHQSLGRSLSEGSCVCSRLTCTSGFSPLNVRHKHCQSKTQPLEQNL
QPVQNLPISHSETVRSGNLSCESKRDSNEEEGGGFTVSTQSPKDLRTSETLLTQTENSGS
NVLKVQMILEELLSTERQYVKALGYVREHYFSELERPDVPQDLRGRRGSVFGNLEKLHDF
HHHHFLNELESCVDEPFRVGRCFLRHRESFALYALYSKNKPQSDSLLINHGQAFFKQKQL
KLGDKMDLSSYLLKPVQRISKYSLLLQDMMMECGPGQTREVAEVKAALEVIDFQLHHGNN
LLAMDAIHHCDVNLKEQGQLIRQDEFLVIFRKKKCLRHIFLFQELILFSKTRKTDVGNET
YIYKQSFKTSDVGMTQNSGDSGLCFEIWFRKRKTQDTYTLQAASREVKDAWTKDLERILW
EQAVHNREVRMQERVFMGIGNKPFMDIQPSDAAINDRAVNYVPMGRGKQKLPVKNLRCSS
SSSSSSGRSSLSPVGYMCVPKRRGAGGGLGGYVSPAGALEEDDLDHENGSHNLLLDSSES
SGESVSGFSSSSHS
Download sequence
Identical sequences G3NZJ8
ENSGACP00000010771 69293.ENSGACP00000010771 ENSGACP00000010771

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]