SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010799 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010799
Domain Number 1 Region: 270-465
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 7.85e-58
Family BCR-homology GTPase activation domain (BH-domain) 0.0000000396
Further Details:      
 
Domain Number 2 Region: 24-160
Classification Level Classification E-value
Superfamily SH2 domain 5.12e-25
Family SH2 domain 0.000000247
Further Details:      
 
Domain Number 3 Region: 200-264
Classification Level Classification E-value
Superfamily Cysteine-rich domain 8.37e-18
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0000582
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010799   Gene: ENSGACG00000008146   Transcript: ENSGACT00000010821
Sequence length 465
Comment pep:known_by_projection group:BROADS1:groupXX:9600510:9619677:-1 gene:ENSGACG00000008146 transcript:ENSGACT00000010821 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAASSNSSLSGSSLSSDPEDYQPPIWKSYLYQLQQEAPRPKRITCPQEMENRPKYYGREF
HGMISRQYADELLAGAEGAYLIRESQRQPGTHTLALSFGHQTLNYRLFYDGKHFVGEKRF
ESVHDLVTDALITLYIETKAAEYIAKMTTNPIYEHLGYTSLLKDKMVHRLSRGRTEPRRV
TFQRDEKISSPLVRRSALKDTPEKQCSYEKIHNFKVHTFRGPHWCEYCANFMWGLIAQGV
RCSDCGLNVHKQCSKLVPSDCQPDLRRIKKVFSCDLTTLVKAHNTTRPMVVDMCIREIEL
RGMQSEGLYRVSGFSEHVEEVRLAFDRDGEKADISAVAYADINIIAGALKLYLRDLPIPI
ITFDLYSKFIQAAKIPNAESRLEGIHESLLQLPPAHFETLRYLMAHLKRVTQFEKDNFMN
AENLGIVYGPTLMQPPEQNALTTLNDMRQQKLVVQLMIEHEDVLF
Download sequence
Identical sequences G3NZM6
69293.ENSGACP00000010799 ENSGACP00000010799 ENSGACP00000010799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]