SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010861 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010861
Domain Number 1 Region: 2714-2983
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.02e-72
Family Protein kinases, catalytic subunit 0.00000304
Further Details:      
 
Domain Number 2 Region: 1233-1411
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.37e-50
Family DBL homology domain (DH-domain) 0.0000000121
Further Details:      
 
Domain Number 3 Region: 1913-2091
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-47
Family DBL homology domain (DH-domain) 0.0000251
Further Details:      
 
Domain Number 4 Region: 1418-1537
Classification Level Classification E-value
Superfamily PH domain-like 9.75e-33
Family Pleckstrin-homology domain (PH domain) 0.000000834
Further Details:      
 
Domain Number 5 Region: 2100-2223
Classification Level Classification E-value
Superfamily PH domain-like 2.77e-31
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 
Domain Number 6 Region: 2611-2706
Classification Level Classification E-value
Superfamily Immunoglobulin 4.07e-22
Family I set domains 0.0048
Further Details:      
 
Domain Number 7 Region: 1045-1184
Classification Level Classification E-value
Superfamily Spectrin repeat 1.13e-20
Family Spectrin repeat 0.0057
Further Details:      
 
Domain Number 8 Region: 247-386
Classification Level Classification E-value
Superfamily Spectrin repeat 1.16e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 797-950
Classification Level Classification E-value
Superfamily Spectrin repeat 5.13e-20
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 10 Region: 465-612
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000041
Family Spectrin repeat 0.009
Further Details:      
 
Domain Number 11 Region: 2476-2540
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000747
Family SH3-domain 0.00015
Further Details:      
 
Domain Number 12 Region: 1585-1675
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000166
Family SH3-domain 0.0026
Further Details:      
 
Domain Number 13 Region: 165-280
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000406
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 14 Region: 617-724
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000018
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 15 Region: 20-156
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000209
Family CRAL/TRIO domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010861
Domain Number - Region: 391-505
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00623
Family Spectrin repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010861   Gene: ENSGACG00000008174   Transcript: ENSGACT00000010884
Sequence length 3028
Comment pep:known_by_projection group:BROADS1:groupX:12578694:12611207:1 gene:ENSGACG00000008174 transcript:ENSGACT00000010884 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAMEVLPILKEKVAFLSASGGRDRRGGPVLTFPSRSNHDRIRTDDLRRLIGYLAGIPSE
EVCKHGFTVIVDMRGSKWDSIKPLLKILQESFPSCIHVALIIKPDNFWQKQRTNFGSSKF
EFETTMVSLEGLTKVVDPSQLTADFDGSLEYNHEEWIEVRVAFEEFSGHATQMLSRLEEM
QETVSRKDFPQDLEGARRMIEEHATLKKKVIKAPIEELDTEGQRLLQRIQSSESFSNRRM
CNADTQGLVPRITQLLDKLHSTRQHLHQAWHVRKLQLDQCFQLRLFEQDAEKMFDWIMHN
KGLFLAGYTEIGNNHPHAIELQTQHNHFAMNCMNVYVNINRIMSVGNRLLESGHYASQQI
KQISGQLEQEWKAFAAALDERSTLLEMSASFHQKCDQYMGNVDTWCKACGEVDLPSELQD
LEDAIHHHQGLYEHITAAYSEVSQDGKALLDKLQRPLTPGSADSLTASANYSKAVHHVLD
IIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDGIENHGEAFFSKHTGVGKS
LHRARVLQKRQEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQLEDRIQDF
VRRVEQRKVLLDMSVAFHTHVKELWTWLEELQKELLDDVYAESVEAVQDLIKRFGQQQQT
TLQVTVNVIKEGEDLIQQLRDSAISSNKAPHNSSINHIESVLQQLEEAQGQMEELFQERK
IKLDLFLQLRIFERDAIDIISDLESWNDELVGQMTEFDTEDLTVAEQRLQHHADKALTMN
NLTFDVIHQGQELLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQELDLAAEQH
RRHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHEQFQHAIEK
THQSALQVQQKAEALLQANHYDMDLIRDCAESVASHWQQLMLKMEDRLKLVNASVAFYKT
SEQVCSVLESLEQEYKREEDWCGGADKLGPNCETDHVSPMITKHLEQKEAFLKACTLARR
NADVFLKYMHRNSVNMPGMLSHVKAPEQQVKNILNELLQRENRVLHFWTMRKRRLDQCQQ
YVVFERSAKQALEWIHDTGEFYLSTHTSTGSSIHHTQELLKEHEDFHITAKQTKERVKLL
IQLADGFCEKGHSHAGEIKKWVTAVDKRYRDFSLRMDKYRCSLEKALGISSDSNKQSKDL
QLDIIPATAPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKTYVRDLRECMDTYL
WEMTSGVEEIPPGIINKEHIIFGNMQDLFEFHHNIFLKELEKYEQLPEDVGHCFVTWADK
FQMYVNYCKNKPDSTQLILEHAGNYFDEIQQRHRLANSISSYLIKPVQRITKYQLLLKEL
LTCCEEGKGEIKDGLEVMLSVPKKANDAMHLSMLEGFDENIESQGELILQDSFQVWDPKT
LIRKGRERHLFLFEMSLVFSKEVKDSNGRSKYIYKSKLFTSELGVTEHVEGDPCKFALWV
GRTPTSDNKIVLKSSSIENKQDWIKHIREVIQERTIHLRGALKEPIHIPKTTTAKPHRGR
GRDGEDLDSQGEGSSQPDTISLASRTSQNTLDSDKLSGGCELTVVIHDFMASNSNELTVR
RGQTVEVLERCHDKPDWCLVRTTDRSPAMEGLVPCAMLCIAHSRSSMEMEGIYNHKDTLS
VCSNDSIMPGSSATLQPGHGIGSHASPGPKRPGNTLRKWLTSPVRRLSSGKADGHVKKLA
HKHKKSRDVRKSGEVTMGSQKDSDDSAATPQDETVEERVRNEGLSSGTLSKSSSSGMQSC
GEEEGEEGADSVPLPPPMAIQQHSLLQPDSQDDKECWRLKRKQTSSRTPSARHMLETKEA
LISALYALEDRPSSLSVEPGDSSSPSFNPSDNSLLSSSSPIEEVDERRTGALKKRHYVLL
ELVETERDYVRDLSLVVEGYMSRMKEEGVPDDMKGKDKIVFGNIHQIYDWAQSFYLGELE
KCLEDPDRLGPLFLKQERRLNMYVVYCQNKPKSEHIVSEYMDTYFEDLKQRLGHRLQITD
LLNKPVKRIMKYQLLLKDFLKLSKKAGLESVELEKAVEVMCIVPKKCNDIMNVGRLQGFD
GKIVAQGRLLLQDTFMVSDPEGSLLGRMKERRVFLFEQVVIFSELLDKKKGFSAPGFLYK
NSIKVSCLGIEETMESDPCKFILTSRSTNGTVESFVLHSSHAGVREVWTLQIGQILESQR
NFLNALTSPIEYQRNHVGASGGAPTAGGGSGVAAGVVGGSSPASAVPLMTPGGSRRPSRI
PQPSRLPQPLRHHPGADPDGPNKMSGTMKDLTEVYDPGPSPCPAPPTLRPSGGSPQGKRP
GQTPEDPAPTAASASGVAPVPRATVGPLPSAPTSKPRPGAVSPMAPPLATPAFGKDGLPP
PPPSPGPKSASGFWSSMPGSPASRPGSFTFPGEAGESPSQTHRHSTHSKEADRMSTCSSA
SEQSIQSTQSNGSESSSSSSVSTMLVTQDYMAVKEDEISVSQGEVVQILASNQQNMFLVF
RAATEQGPAAEGWIPGFVLGHTSAIAADCPEGSMKKPSSWHTSLRIRKKSEKKEKEAKKD
GKLENGYRKSREGLANKVSVKLLNPNYIYDVPPEFLVPLSDVTCDNGDGVTLRCKVCGRP
RAAVTWKGPDQSNLTSNGHFSIAYSDTGEATLRISGAASEDDGVYTCVATNELGSVTSSA
SLRVLAVSTCGIRVSWKDNFESHYTEVVELGRGRFSVVKRCDQQGVKRLVAVKQVNKKLM
RRDRVTQELNLLQRLQHPNIVSLIDTYETPSSYALVLEMADQGRLLDYIVSWGNLTEEKV
ACYLKDILEALHYLHNCRIVHLDVKPENLLVANDSSGQPTVKLTDFGDAVQLSSLPYVHP
LLGSPEFASPELVLGEPVSLTSDLWSLGVVTYVLLSGASPFLDESAEETCLNICRLDFSF
PRDYFQGVGQAARDFICLLLRTDPGRRPPAGLCLQEAWLQAGPADGPARAEGCLDTSRLV
SFIDRRKHQTDARAIGGVRSFIQGRPSA
Download sequence
Identical sequences G3NZT8
69293.ENSGACP00000010861 ENSGACP00000010861 ENSGACP00000010861

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]