SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010868 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010868
Domain Number 1 Region: 64-266,547-715
Classification Level Classification E-value
Superfamily Cysteine proteinases 4.32e-95
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000309
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010868
Domain Number - Region: 264-316
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0557
Family Ubiquitin-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010868   Gene: ENSGACG00000008214   Transcript: ENSGACT00000010891
Sequence length 1266
Comment pep:known_by_projection group:BROADS1:groupV:10080845:10088948:-1 gene:ENSGACG00000008214 transcript:ENSGACT00000010891 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSVRSVGSFMNRVLRTLSTLSHFGTDEQAAEDEKDDSSLVPSTTGGSVPSDDSDCGGFPF
GDKVPGVAGLKNHGNTCFMNAILQCLSNTELFAEYLALEQFRGGETTGGGGGERAKPNGV
LVQKKGSQQQDSGEVTEQLSGLVRALWTFEYTPQHSRDFKNVVSKSALQFKGNSQHDAQE
FLLWLLDRVHEDLNHIIQPDIRPPSKPPVEEESAPEGSPLPAPGSFVQELFQAQYRSSLT
CPHCQKQSNTFDPFLCISLPIPVPHTRPLYVTVVYQGKCSHCMRVGVAVPLSGTVSRLRQ
AVAQETKIPSQQIVLTEMYFDGFHRSFCDDDDDLEIIQESDSIFAFETPELFRPEQIRSK
RSGSPHANLNQNNLKYGTDNNRISTQIQEPTTPPQSPNKNSEQAEKIVLLVCNRACAGQQ
GRRFGNPFILYLERTVTWDVLQKEILEKMRHLLRPGVLAQVGPFTLRVVGVVGITYLLPQ
EEQPLCHPSVERAFKSCGPGGPPHVKIVVEWDKETKDYLFKRTEDEYIPDAESVRHAKEQ
HLQPQTCSLAQCFQLYTKEEQLAPDDAWRCPHCKQLQQGSIKLSLWTLPDILILHLKRFR
QDGDRRMKMQNMVRFPLIGMDMAPHMVKRSQSSWSLPSHWSPWRRPYGMGRDPEDYLYDL
YAVCNHHGTMQGGHYTAHCKNSIDGQWYCFDDSDVQPLSEDAVCKQTGYILFYQRRATIP
SWSANSSVGGSTSSSLCEHWIGRLMGSRPPSQASSGSSRRTSLASLSESAEFAGERSEDD
AGLSSRPAVRGMQRQTFSSRSSIASPLVLSENSGKPSWSHSAKLQLRSNSPSRFSLESHS
SSPTLEMIGEVADTKLSPKLDKSSGGKSALAALDSKRLAEQVPSKAAAQAEQQSGAPPGE
DNAAAGAAEQVSPRHGAAAKDPKPRNGSADSACAKRTSASPKKRPATSSTSSSSLSPASP
AVDKSPPRAQAKSAASATSSKDKSDGPAKTGKGGSSRTATPLKKGSSQTTEVLRPDSAQQ
RSGSPGSQSSHPQKKTSPRGEKSSVSARTKGADRSASRESSRNNVVSEKKVNHGGPPRPS
AASRAEGRPGRAAENRAAGRSSSSSSSVTSLRSSSVGVPSASGAPPSRGPQRNSKTEDKG
LSFFKTALRTKETRKAADGGKAGPGEARAGPEDGAGDGSREGVQQAAGKSVAPGAQANGT
AAKDKESSKVSAAAKHSLPPSARSKLPGADAAPQASATGKDPSKKEPAKKTMASRKIPIS
STQTSQ
Download sequence
Identical sequences G3NZU5
69293.ENSGACP00000010868 ENSGACP00000010868 ENSGACP00000010868

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]