SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010870 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010870
Domain Number 1 Region: 648-855
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.83e-50
Family DBL homology domain (DH-domain) 0.00032
Further Details:      
 
Domain Number 2 Region: 1282-1495
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000000000141
Family Quinoprotein alcohol dehydrogenase-like 0.036
Further Details:      
 
Domain Number 3 Region: 849-955,1020-1052
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000236
Family Pleckstrin-homology domain (PH domain) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010870   Gene: ENSGACG00000008207   Transcript: ENSGACT00000010893
Sequence length 1622
Comment pep:known_by_projection group:BROADS1:groupI:6847350:6887280:1 gene:ENSGACG00000008207 transcript:ENSGACT00000010893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TKKNHISMSNPDIASETMSLLSFLKSDLSELKVRKISGDKSWAPDGSPVYRMGLRNQVSN
PLPSGCRPSLKDLTATLRRAKSFTYSDKPTTAVRCYLTGGAAKRSSSEQQLDLDGEDDGG
RVFVTEREERYVQEARQVIRDICQMSTREDDDVDMNALLKGHSEESMFYDRSVDELSGHE
SSLTDEGIVTEPETGPSDPSERSFLGSAGVNLGNNVNAACDEINTNAAVSQRSAGTTGGG
LEAPATPSSNRRRRKFSPSGINNTGSDSSNGSNAESTMAAVGNGESTVYRSLSDPMPQRH
CSATEEGNNTFSSVDSNLLGSLSVKGGGGAADASAVATMSEYKGSAASDLSVYSDGGLLR
DDAIHDYSGVIRSIVAEPGAMDRLMTDDHGNGKFPKKKSFSDPSRRSDAPLLNDPQFKCQ
TGSTEPIGELDLPGQIPPSSSEPILSEQREELWKPESDNRDDEDDDLIDQGEEETEVQQF
NFNLKLAEVLSPRMVRRPTRKRPNRAEQGSEEQEDHGHQTDLTPLQSKAKTRSKHVRHAS
EPAAFLPISPPPQLQPLKEVDSFSVASTAEPQTSGKPPGEEAPSLEAVTQKYILGTAECP
GPPPAARKCLSSRSPVPPRPSPSFPSQLSSCIRPKLNRKCCGCLPVDDMRKHVMMTLLDT
EQSYVESLRSLIQGYLRPLKQPDCGCIVDPLLVDEMFYQIPEILEHHEHFLEQVAGCVGQ
WHDRQTVGHFLIQSFSKETLANMYSAYIDNFLNAKDAVRIAKEAKPAFHKFLEQNMRENK
EKQALGDLMIKPVQRIPRYELLVKDLLKHTPEDHPDHPYLLDAQRDIKRLAERINKGRRS
AEEAEREARVIQEIEAHIEGVEHILNPQRKFLRQEMVMEAKTVGGKKDRSLFLFSDLIIC
TTLKRKSGSLRRSSMSLYSAASMIDTSSKYKFLWKLALEDVEVVKSSTQATNKENIQRMI
SRLDEDLGTLGQISKLSENLSFPHQSLDEVLKDLVASVHRELSEKQSLAFSMTFLPTKLE
FTTASAESSFVFEFASPDMRSNFEQAFEDAKKKLAMNKDQWDPEFLKAIPIMKTRSGMQF
SCASPSHSCPDSGCEVWVCNSDGYVGQVCLLNIKDEPTVEACIAVCSARIICIAAVPGLK
GRSVEAEERGSEPAPAAASGHTQQQLHISIGHSSLELTERRAAGPAGAELVPFDSDDTDD
EDSPSPSSTLQSQASHSTISSSYGNDEGPSSKDMATETTSSEEEQEFPVASSYGAESAMD
GRAMRRSSRGSFTRASLEDLLSIDPEAYQSSVWLGTEDGCIHVYQSSDNIRNRKNSMKMQ
HSASILCILYLDNKVFVALASGEVIVYQREAGSFWDPQSSQTLVLGTPSSPVTKMVPVGG
KLWCGSQNRVLIINTTTLVQEHWFQVGTDSSRCVTCMVAYGQGVWLALQGSAQVKLYHAQ
TLESLTEVDVAPAVHKMLAGADAIIRQHKAACLRITALLACKDLLWIGTSAGVVLTLVIP
AVSSGTVAGTLKVPQVPMGSAHGHTGHVRFLTSIELPEGFDMNFPPTPTDSTGNQCQSSS
SAVDANLQRRDSARRRASAHIPSKSNHLVISGGDGYEDFRLTNSSETVGRDDSTNHLLLW
KV
Download sequence
Identical sequences G3NZU7
ENSGACP00000010870 ENSGACP00000010870 69293.ENSGACP00000010870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]