SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010880 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010880
Domain Number 1 Region: 362-542
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.71e-47
Family BCR-homology GTPase activation domain (BH-domain) 0.0000943
Further Details:      
 
Domain Number 2 Region: 286-339
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000942
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010880   Gene: ENSGACG00000008215   Transcript: ENSGACT00000010903
Sequence length 626
Comment pep:known_by_projection group:BROADS1:groupXVII:7758527:7764054:-1 gene:ENSGACG00000008215 transcript:ENSGACT00000010903 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEASVVNLYNQFQSLRAQVDGLNEGIEPQFLQMAIHFEECRKKWLRAGEELVSCREVLSK
AETERGALEVKLKHARNQVDVEIRRRQKAEAVHEKLERQLQLIRELLISENNGNSVHLSE
EQRSALAFLSAHSQAAQAAMSNVNTSRRLTTIDESASLLSDISYDQTDDSLDWDASAMRT
VRLRKRQKRRSSRKLSEVPPLAMKKPRSTGRTSEGMNESIVAKTTITVPGNGGVVEAVST
IETVPYRTRSRKNAWGDTTTTDQSDAQSTPVSILPIQLQTLRTNRGGKTHQFIPKTVIKS
EFCLPCGRRTKFGKMYLRCQDCKVATHPECRANCPLPCNPLVLSTPVPNTENTLADFAPL
SSPKIPAFLLYCIKEIEHRGLHEVGLYRVSGQERMVKELKEKLIRGKTVPPLHKVDDINV
VAGVLKDFLRNLPEPLLTFHLNKVFMEAAEIQDDDNSLAVLYQTISELPQPNRDTLACLM
IHLKTVSECVDTKMDVNNLARVFGPTLVGHAVPDPDPMTILHDTSRQPRVVERLLSIPVN
YWGQFAYPDNTSMDNAHHADTPDHNVSILGPVTTPEHQRMAKTPSSGSLTQRMKQTLSST
TIFGSKSKASAASNRQGNFFASPQLK
Download sequence
Identical sequences G3NZV7
ENSGACP00000010880 69293.ENSGACP00000010880 ENSGACP00000010880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]