SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010891 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010891
Domain Number 1 Region: 488-599
Classification Level Classification E-value
Superfamily SH2 domain 2.29e-29
Family SH2 domain 0.0000026
Further Details:      
 
Domain Number 2 Region: 170-263
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.18e-27
Family Ras-binding domain, RBD 0.00016
Further Details:      
 
Domain Number 3 Region: 294-408
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-17
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010891   Gene: ENSGACG00000008225   Transcript: ENSGACT00000010914
Sequence length 603
Comment pep:known_by_projection group:BROADS1:groupX:12619123:12643081:-1 gene:ENSGACG00000008225 transcript:ENSGACT00000010914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALAGCPDYFLHHSNYQENMDRTSARRPEELIVPGFQRSANQNLPHHHEDDVDLEQLVND
MNSSMESVYSTQADTARLLNNGHAAAPHQHHQQQQQHHPGHGQAHRRHTPPLLPSPPSRD
RPRPSQPMHIHAVRCLQKKHLLRPASLPAIPNPFPELCSPDGSPVLCPLQTSNDHIVKVW
SEDGAGKAVEIPAHMTARDLCQLLVYKSHCVDDNAWTLVEHHHALGLERCLEDHELVVQV
QASMSSDSKFLFRKNYAKYEFFRNPLNFFPEQMVAWCQESDGSIPQSQLLQNFLNSSSCP
EIQGYLHVKEPGRRSWKKLYMFLRRSGLYYSTKGTSKEPRHLQLLSDLEDSNIFTVITGR
KLHNAPTDYHFCIKPSKVTSDGKELKMLCAEDEQSRTCWMTAFRLLKYGILLYQSYNVPQ
QRKSNLPPFSAPVRSASENSLVAMDFSGRTGRVIENPLEAQSAALEEGQSWRKRSQRMNV
LGSPSPLHPSSLSTVIHRTQIWFHGRVVREDAHKMIIQQGQVDGLFLLRDSQSNPKAFVL
TLCHHQKIKHFQILPCEEDGQVFFSLDDGATKFTDLIHLVEFYQLNRGLLPCKLKHPCTA
VAL
Download sequence
Identical sequences G3NZW8
69293.ENSGACP00000010891 ENSGACP00000010891 ENSGACP00000010891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]