SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010944 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010944
Domain Number 1 Region: 849-913
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.01e-21
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010944   Gene: ENSGACG00000008275   Transcript: ENSGACT00000010967
Sequence length 923
Comment pep:known_by_projection group:BROADS1:groupXV:5534034:5550920:1 gene:ENSGACG00000008275 transcript:ENSGACT00000010967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RYRTGGSVTKEGGEVTMNRFRKWLYKPKRTDPQLLAQFYYADEELNQVTTELDGIDGRKD
PQRCTLLVNQFRSCQDSVLTIINQIMDECIPEDRANRDFSVKFPEEIRHDNLAGQLWFGA
ECLAAGSIIMNREIESIAMRPLAKDVTRSLEEVRNITRDQALRDLNLYTDRMRDAMRHFD
GLFAEFELSYVSAMVPVKSPKEYYVQQDVIVLFCETVERALKLGYLTQDMIDDYEPALMF
TIPRLAIVCGLVVYSEGPLNLDRKSEDISELFRPFRTLLKKIRDLLQTLTEEELISLERN
LCITQDGDLSVGQEQAMDCSPTPVQENPSSCSPANDTYKGESEAEEAELACSMQYDEEEL
EQLNMMVYRVGDEMSTFLSPPSQGHSPARNPHAGVAGGSGGSFSAEASPRRLLGGRGRTG
IYLEEEDKVFHMEDLDAEGDGITSISREACRCVASPTKAPDSAPPVQSKLGPPPGAARSG
WDSAAQSEQPCPQPRGPSTHCPKAKHPPCTSAPGSESLPYANGWEMGLEGTASETAEVIA
HRMGGMKLSATVIFNPRSPSSTELSVDKLLPRPAPSEIESCGPLVATHCLLNSCVCCGSC
EDGHEDAVAAESTGLRGLALGLDNLCKTAAPSAVFRPAACRLPAQGHEPLGKRELARLTP
PSSCRSAEDLEEDSNPQLSNEKREQASGGRQGDEDTDKDKLGTKVLKRDTKEDGRTSSSP
VSSLTPSSGMSDLDHQEIHLALRHAKLAARNKIRSRFHSSSDLIHRLFVCISGVADQLQT
NYASDLRSILKTLFEVMATKCEEGGNDNQKKGPVLRSAVLEDCALCQETISSSELAAKAR
DGQFEDPPDWVPDEACNSCIACKAPFTVIRRKHHCRSCGKIFCSRCSSHSAPLPRYGQVK
PVRVCTHCYMFHVTPFYSDKAGI
Download sequence
Identical sequences G3P021
ENSGACP00000010944 69293.ENSGACP00000010944 ENSGACP00000010944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]