SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000010991 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000010991
Domain Number 1 Region: 574-825
Classification Level Classification E-value
Superfamily NHL repeat 2.88e-40
Family NHL repeat 0.00051
Further Details:      
 
Domain Number 2 Region: 462-554
Classification Level Classification E-value
Superfamily E set domains 1.13e-21
Family Filamin repeat (rod domain) 0.0017
Further Details:      
 
Domain Number 3 Region: 239-301
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000000000000106
Family B-box zinc-binding domain 0.0037
Further Details:      
 
Domain Number 4 Region: 46-98
Classification Level Classification E-value
Superfamily RING/U-box 0.000000482
Family RING finger domain, C3HC4 0.021
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000010991
Domain Number - Region: 164-198
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000777
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000010991   Gene: ENSGACG00000008309   Transcript: ENSGACT00000011014
Sequence length 825
Comment pep:known_by_projection group:BROADS1:groupX:12801925:12821223:1 gene:ENSGACG00000008309 transcript:ENSGACT00000011014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASFPDSDLQTCPLCKELCGSSAPISSSSSTSSSSSHTSSSSSQTTRRLHVLPCLHAFCR
QCLEGQRSPGDPLKLRCPTCDQKVCISEAGVDSLPSSNFLFSNLLDVVVSSEEQIHNKNG
HHLLHHHHQQQQHNNHHQQHHLRGGLGGGSSGFHHPHGGLLHPGHLGEPQCSSCDEENPA
TSHCLDCQEYLCDNCVRAHQRVRLTKDHFIERLGDNLHLGRVNVNSNPGQPGNNFALLSL
FQDQMSFCQHHDNEVFLFFCESCSVPICRECSVGRHMGHTFVYLQDAVQDCRAVTIQLLA
DAQQGRQAVQLSMEKVQAMAEQVEIKAKVVQTEVKALVLRHKKALEERECELLWKVEKIR
KVKAKSLYLQVEKLHQSLTKLDSTIAAVSQVLDEGRHLDVLLARERMLTQIHELKALRGL
LQAQEDDRFMFTPPDQALYVAIQSMGLISSGAFAPVTKAHGEGLKTALRGKPASFTVIGY
DHDGEPRLSGGDAVSAVAVAVPDGNLSAAEVTDHQNGSYTVGYLPKCEGEHLVSVLVCNQ
HIQGSPFKVTVKSGRSYGSLGNQVSSFGSEGEGDGQLCRPWGISVDKEGYVVVADRSNNR
IQVEHREHAATRPTAVNCTSSRPSSSRRSPTGSTRVFTFEGQFLLKFGEKGTKNGQFNYP
WDVAVNSEGKILVSDTRNHRVQLFAPDGSFLNKYGFEGALWKHFDSPRGVAFNHEDHLVV
TDFNNHRLLVIRPDCQSARFLGSEGVGNGQFLRPQGVAVDQENRIIVADSRNHRVQVFEP
NGNFLCKFGTQGSGFGQMDRPSGVAVTPDGVIVVVDFGNNRILKF
Download sequence
Identical sequences G3P068
ENSGACP00000010991 69293.ENSGACP00000010991 ENSGACP00000010991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]