SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011001 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011001
Domain Number 1 Region: 14-216
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-47
Family Pleckstrin-homology domain (PH domain) 0.000000305
Further Details:      
 
Domain Number 2 Region: 269-346
Classification Level Classification E-value
Superfamily SH3-domain 9.58e-17
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011001   Gene: ENSGACG00000008317   Transcript: ENSGACT00000011024
Sequence length 350
Comment pep:known_by_projection group:BROADS1:groupXX:9736842:9744981:1 gene:ENSGACG00000008317 transcript:ENSGACT00000011024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QPLQSCTDMMQPIPEKFTTLISDLEFFLCDGLKGESLSKKAKEKKDALIKRIKEAKLSFP
QDFKDKSGDDSDNEEEIDSNNDGGSMVSERADKDEEAFEGAHQFPPMAAQDLTSVFKAGH
LEKRRKDHSFFGTEWQKRWCALSHHIFYYYGSEKDKQQKGEFSIDGYTVKMNSTLRKDSK
KDCCFEISAPDKRVYQFCASSSKEAEEWVKQIDFVLRDMCGIIPEDEEEPELYDDVGAIE
DKVESEPIDDDIYEMLPEEDLPTPAKPPPKFEPAMKPAPPPSVDKSTDFPNFYQGLWDCT
GDHPDELSFKRGDAIYILSKEYQSFGWWVGEKSGAVGIVPKDYLMELYAL
Download sequence
Identical sequences G3P078
ENSGACP00000011001 ENSGACP00000011001 69293.ENSGACP00000011001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]