SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011027 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011027
Domain Number 1 Region: 54-108,167-309
Classification Level Classification E-value
Superfamily PH domain-like 1.26e-40
Family Pleckstrin-homology domain (PH domain) 0.0062
Further Details:      
 
Domain Number 2 Region: 5-82,119-185
Classification Level Classification E-value
Superfamily EF-hand 0.00000039
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011027   Gene: ENSGACG00000008311   Transcript: ENSGACT00000011050
Sequence length 619
Comment pep:known_by_projection group:BROADS1:groupXII:10464460:10472941:-1 gene:ENSGACG00000008311 transcript:ENSGACT00000011050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLRSELLKSIWYGFTALDLEKSGKVSKSQLKVLSHNLCTVLSIPHDPVALEEHFRDDDD
GPVSSQGYMPYLNKYILDKVIEGSFIKENVDELCWTLTAKKNYQTDKASSTVLPERDAFR
LWCIFNFLSEDKYPLVMVPDEVEYLLKKTCMAMSIEFNCVELEDFFSQDSVQQSGITVWV
FLEMMNSGKMARGIDKSIISMAIEEVYREIVGDVLKEGYLWKKGQLRRNWKERWFTLRPS
NLSYYTGEDRKDCQGHIVLDGNCCVEVLPDRDGKRCMFCLKTLSKTYEMSASDTKQRQEW
TTAIQTAIRLHVEGKTSLHKDLKLKRREQREQREKRRQSKEEELQKLRALQEERERKLEE
LDLLKEAQKQAQVLLEQDEQRRRQQHEQLQRALEVQLREAEEARVSMQAEMALKEEEAER
QRKRIQELEEMQKRLEEALQQEIKARLDEESFRLAQAGLLAEEEEKMKALMSLQEEQEEY
ILKTQREKQELKQEMEIKSRSLDEAQRQLEEVRANRHRVDQDVVAAQRKLRQASTNVKHW
NVQMNRLMRPIGPGEKRPSLGSSFSSFQMPTQRDPGLRLRRRSGSEDQDEESKENVDSRP
GSDLEKRHSHKSNGDMDIP
Download sequence
Identical sequences G3P0A4
ENSGACP00000011027 ENSGACP00000011027 69293.ENSGACP00000011027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]