SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011071 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011071
Domain Number 1 Region: 319-420
Classification Level Classification E-value
Superfamily Bromodomain 3.27e-23
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 2 Region: 158-242
Classification Level Classification E-value
Superfamily SAND domain-like 1.71e-21
Family SAND domain 0.0017
Further Details:      
 
Domain Number 3 Region: 28-103
Classification Level Classification E-value
Superfamily SAND domain-like 1.71e-21
Family SAND domain 0.00081
Further Details:      
 
Domain Number 4 Region: 253-307
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000354
Family PHD domain 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011071   Gene: ENSGACG00000008377   Transcript: ENSGACT00000011094
Sequence length 421
Comment pep:novel group:BROADS1:groupXI:5239884:5245046:1 gene:ENSGACG00000008377 transcript:ENSGACT00000011094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KEESDKEKRKALSDRFAATPRKKGKENNIWSWPFFKLQLPVTCGDRKGTLDRQRLAKGER
CIVVEKRWFSPPEFEIFAGKKSSRKWKSSIQCMETPLEKLIQFFFFVSFAPLQEGHLQAA
KYKRDPKKAKKSLFPSGDVTIVSSGDEEEEEDRDLHDKRMFKVTCGASDGTFYKNRFVSG
TRGKSIRTETSWMTPVEFLELALGRKDASWKKDIECEGKPLFVLIKAETLTIHSLLCNCN
LCKPDDEDQRNQKNDDECCICRREGDLVMCDNCPRSFHKKCHLPHVENGLLRPWFCTFCV
FRSNEHYFGSEELESALSYNISQHQQQCQCLLLCLWSADEEQIFAANPCRYLNNYSKVIE
TPMWFGHIAGKLQQKLYQTVGEFVTDVRLIFSNCALYNRKNAEVLVIGKRLKELFDRKFK
S
Download sequence
Identical sequences G3P0E8
69293.ENSGACP00000011071 ENSGACP00000011071 ENSGACP00000011071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]