SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011086 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011086
Domain Number 1 Region: 522-881
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 1.01e-124
Family Oxysterol-binding protein 0.0012
Further Details:      
 
Domain Number 2 Region: 50-153
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000712
Family Pleckstrin-homology domain (PH domain) 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011086   Gene: ENSGACG00000008359   Transcript: ENSGACT00000011109
Sequence length 887
Comment pep:known_by_projection group:BROADS1:groupXX:9795135:9808015:1 gene:ENSGACG00000008359 transcript:ENSGACT00000011109 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSEERSSAMSQKISSASRSNSSASSKLDSRQDSWEIVEGLRGGFSSVLEPQKQEGFMLK
RRKWPMKGWHKRYFFLDKGILKYGKCSADIERNKLHGCIDVGLSVMAIKKKAKCIDFDAE
ENIYHLKIKSQELFDEWVSKLRHHRLYRQNEIALYPTEKSFYYPHYPSPISSSMAESASI
RKCVTTQRQSMGNSAGDFPPSCHSQAKVAAWLQSSDDMDKCSKDLSVCEAGLLELSHLLQ
SMEVLHRTYSAPSIQALQASTFDSPKKEKRLPRKWCTKNYNKDVKSTLQVPSCISSGSIR
LHASNPNLSTAALANDKADTESVDSTFDVAKLHEDFFRVATNLHLTMKTALSSLTSERER
LKQCVNHETIPPTSPRVVGLKNTLATALAQNYELRERLSKIHAESHILEPTLNLTAPVQK
QDSVDDSRPLVHQISNESGASITESMTEFFDAQEVLLSASSSENEVSEDDSYISDISDNI
SIDNLSNETEGERPNSGKLRDKCFGPDLINLRRSCLPSPSPNNSTISLWNILRNNIGKDL
SKVAMPVQLNEPLNTLQRLCEELEYSELLDKAANTQDPFERMVYIATFVVSGYASSYYRT
GGKPFNPVLGETYECERPDKGLRFVAEQVSHHPPISACHAESKNFLFWQDVRCKNKFWGK
SMEIVPVGTTHVTLPGFGDHYEWNKVTSCIHNILSGQRWIEHYGEISIRNSSSDICQCKI
TFVKAKYWNSSGNEVEGAVTDNKGKVVHRLFGKWQEAVFCGDPPSATCVWRANAMPVDLE
QYYGFTKFAIELNELDPSLQLLLPPSDTRLRVDQRLLETGNLEAAEEHKQRIEELQRERR
KVLEENNETHQPKFFRKSKDDTWVSNNTYWELRKDPGFTQIDFPVLW
Download sequence
Identical sequences G3P0G3
ENSGACP00000011086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]