SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011090 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011090
Domain Number 1 Region: 345-439
Classification Level Classification E-value
Superfamily PH domain-like 5.63e-22
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011090
Domain Number - Region: 40-88
Classification Level Classification E-value
Superfamily PH domain-like 0.000164
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011090   Gene: ENSGACG00000008379   Transcript: ENSGACT00000011113
Sequence length 2173
Comment pep:novel group:BROADS1:groupV:10371534:10399882:1 gene:ENSGACG00000008379 transcript:ENSGACT00000011113 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMSLKDNSCRKFQANIFNKSKCQNCFKPRESHLLNDEDLNQAKPIYGGWLLLAPEGTNFD
NPLHRSRKWQRRFFILYEHGVLRYALDEMVSAAERGFPRQGRVVSVEPNPPDCYATISLC
RFPNSQHFVRASRLPLASSRRVGAAPRTRAHISLCDLTSHCVLPSSPPTQTRPQEPGPAK
VTVTSSAGGGLPCLPGAERVPMSRSSLWQEEHRWSRAAIPCSRSASCVSQLSQSRPDARV
AAQDDGGTVSAGRKARVESGYFSLEKTKSEPPPQHQPPQHLPLGSPAPSVRRSQIIGRFE
EGPPEERMDTSTSSEPCADTPLTQRQGRSERRYLANKHPDLLNFKKGWMTKLYDDGMWKK
HWFVLTDQSLRYYKDSIAEEASELDGEIDLSTCYDVKEFPVQRNYGFQILCKEEACTLSA
MTSGIRRNWIQAIMKNVRPTIAPDVTRPSPEAPESHARRQPGSDASSPSFEPRKSRVRER
RREGRSKTFDWSEFKAERTERPPKDRADTVDLSSSFSPASSYCSPSSSPSSLASSPVSAS
SLPASSASALEAETERGPSAADQRDAGTSVVREEIEQRWHQVERTPLREEKQVAINTAPG
NSDRLPAHELAALLDKELGQKQQELDRLQRQNDVLKEQLGDALGKEQSARDGYVLQNATP
SSSSAHRAPWQCLRGLNQDLQGELETQKHKQDLAQQQIRTLKRSYTEAQDAVDHHEAGVQ
ALRSKLASAMAEISASEQAVARMRNELKLEQRRSREQEEEHGRGEATLRAQLKDSEDRLR
DVEASLLERNQALRHLEHQQALQRDHARELHRLQERLQEVIGRLSATEEAHALKEERLRR
EQHGMRESHESERRILCGRLAEAEAAQAETKNRLLEAEQQVEALLRGRQAGSGGQEVPKL
REELAQKADAAESLRESVRRLEEEKGHLTCRCQELLNQIAEADREVSKLRSRLETEEADY
CTLEHSYERATQEFQKISQVLREKEDEIRQTKETYERLVERKEEDLKEALVKMAALGCSL
EETEHRLQAKEELLCRLSPSILETVEPCGAEKDLKAKLVVAKDRIAELEQHLNALQLGYA
DLRAEKPQIPEQSKKSRLKTSASLSADRELSLPFDNASNTDNFPDDKESQAKRPRIRFSS
IQGQKYLNLEGLDASHFSEDLGPREGQTSSETASHQSSDPEKFLSIIRSLEAKLLATENK
LRDLTRRLEEQRRTRAEDAPEPESARGSGSAADERYASALLCVENSREKVGAILGGAGGA
ESQLHSLSAIERDLFSASLYMRQGHETWGQRSPPERQTPEALDGEALRLFAQTLSLEAVV
LNKMASLLQTSKSDVLHSLADVWEDVGDIKRADKGCLAVVYADALTTKLMLESSFCKELE
KAKTGDAESRASVSADVDVDAAVVFNTVVKAELAYSIHELKVCYEDELKTLKGELTLAHD
NLHHREEALKAIIEASKSPDLKNVIKEIKNEFGFSRPRLADVTPPELAPYVEHIEMEEAR
GSAEEIVDRHLAAETAETRGAESIGSLRSAHERLADELQRQAAVLHACAQEIERGGTRPG
PREMLHGALAQQSSRPFTGASLCMRDALVQAQVAYVACRLRALHQEDLGRCRRAGRDMSA
LVQQHAGDVAAIHERYQAALEGERQNFARTAAALQKENQALKSEISKRVNQLSQQQKQLA
LLEGRYKKEAEELRRRHAQELSRAEKGRASAELALVETTSDSRRELEVLLADAGAAEERH
EGRVGELEERFEQRICELQRVHEREMEKLSSQYMRDIQGVQRDQEKIKEPRVPRSCPGDE
AATPMEEEEQGSGEDAELDSMLVLKGRVRELEAQMSTMRDELENKHLEGDVASLREKYQR
DFESLKATCERGFAAMEDTHQKVVHDLQRQHQREISQLMEERERLLAEETAATIAAIEAM
KNAHREELEKTHRSQRSGLNSDIDELRLQYEEELQSIHRELEVLSEQYSQKCLENAHLAQ
ALEAERQALRQCQRENQELNAHNQELNNRLTTEISRMRSCFSGETALSPLTQGSDVYELE
VLLRIKESEIQYLKQEIHSLKDELQSALRDKKYATDKYKGIYTELSIVKAKADCDIGKLK
EKLLVATEALGERAVDGAVPSGYGKREYNSEFQKNKVSPTSSTLRLKSRASLKEGLTVQE
RMKLFEAKDSKKI
Download sequence
Identical sequences G3P0G7
69293.ENSGACP00000011090 ENSGACP00000011090 ENSGACP00000011090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]