SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011154 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011154
Domain Number 1 Region: 2617-2885
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-70
Family Protein kinases, catalytic subunit 0.00000148
Further Details:      
 
Domain Number 2 Region: 1872-2070
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.62e-51
Family DBL homology domain (DH-domain) 0.0000202
Further Details:      
 
Domain Number 3 Region: 1234-1413
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 5.1e-49
Family DBL homology domain (DH-domain) 0.0000000275
Further Details:      
 
Domain Number 4 Region: 1422-1537
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-30
Family Pleckstrin-homology domain (PH domain) 0.00000469
Further Details:      
 
Domain Number 5 Region: 2070-2187
Classification Level Classification E-value
Superfamily PH domain-like 1.42e-29
Family Pleckstrin-homology domain (PH domain) 0.00038
Further Details:      
 
Domain Number 6 Region: 2473-2607
Classification Level Classification E-value
Superfamily Fibronectin type III 6.35e-22
Family Fibronectin type III 0.0017
Further Details:      
 
Domain Number 7 Region: 1048-1188
Classification Level Classification E-value
Superfamily Spectrin repeat 1.7e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 8 Region: 453-594
Classification Level Classification E-value
Superfamily Spectrin repeat 2.44e-17
Family Spectrin repeat 0.0059
Further Details:      
 
Domain Number 9 Region: 231-367
Classification Level Classification E-value
Superfamily Spectrin repeat 4.92e-17
Family Spectrin repeat 0.0065
Further Details:      
 
Domain Number 10 Region: 806-953
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-16
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 11 Region: 2269-2330
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000033
Family SH3-domain 0.0000918
Further Details:      
 
Domain Number 12 Region: 2419-2500
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000035
Family I set domains 0.007
Further Details:      
 
Domain Number 13 Region: 1598-1662
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000761
Family SH3-domain 0.0036
Further Details:      
 
Domain Number 14 Region: 599-660,694-727
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000596
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 15 Region: 144-262
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000157
Family Spectrin repeat 0.0078
Further Details:      
 
Domain Number 16 Region: 2-137
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000379
Family CRAL/TRIO domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011154   Gene: ENSGACG00000008415   Transcript: ENSGACT00000011177
Sequence length 2926
Comment pep:known_by_projection group:BROADS1:groupXVI:16576965:16628180:-1 gene:ENSGACG00000008415 transcript:ENSGACT00000011177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGRDKRGGPILTFPARSNHDRIKQEDLRRLVTYLSTVPSEDVCKRGFTVIIDMRGSKWEL
IKPLLKTLQEFFPAEICVALIIKPDNFWQKQKTNFGSAKFSFETSMVSVEGLAKLVDPSQ
LTEDFEGSLDYNHEEWMELRVSLEEFMSNAVHLLSRLEDLQELQSKKEFPTDVEGSRRLI
DEHTQLKKKVLKAPVEELDREGQRLLQCIRSSDGFSGRNCISGSADFQSLVPKVASLLDK
LHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEKMFDWIRHNKEVFLQSHTEIGRAYQHA
VELQTQHNHFAMNSMNAYVNINRIMSVASRLAEAGHYASTQIKQISTQLDLDWKGFAAAL
DERSTILAMSSVFHQKAEQFLSEVEAWCKVCNEGGLPSEMQELEIAIHRHQSLYEQVTQA
YTEVSQDGKALLDVLQRPLGPGNSESLTATANYSKAVHCILDVVHEVLHHQRRLENIWQH
RKVRLHQRLQLCVFQQDVQQVMDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEDVA
QNTYTNADKLLEAAEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEHRKLLLDMSVSFH
THTKELWSWMEELQKQLLDEVCCDSVDSVQTLIQQFQQQQTATLEATLNVIKEGEELIQQ
LRACVRGPFCCIASIRLSSSIHRDAAMSTNKTPHCSSIAHIQGVLQQLDEAQGQMEELFH
ERKIKLDIFLQLRIFEQYTIEVTAELDAWNEDLSRGASSAGAEDIGLAEQRLKRHAERKA
AMNNMTYEVMQQGQDLHQYIMEVQASGIELTGEKDMDLASQVQELLEFLHEKQQEVELNA
QLTHARLEQILQLRHLQAEVKQVLGWIRNGESMLNASMVNASSLSEAEQLQREHEQFQMA
IEKTHQSALQVQQKAEMMLQAGHYDPEAIRGCAEKVAVHWQQLMLKMEDRLKLVNASVAF
YKTSEQVCSVLESLEQEYRRDEDWCGSHDKVGASADCEHLLPLISKHLEQKEAFLKACTL
ARRNAEVFLKYIHRNNVSMPGAAGHTRGPEQQVKAAILNELLQRENRVLHFWTLKKRRLD
QCQQYLVFERSAKQALDWIQETGEVYLATHTSPGESGEETQQLLSDYRHFRLTAKQTKDK
VKLLIQLADNLVEKGHAHVSELKRWVSAVDRRYRDFSLRMGKYQESLERSLGVSSEDNKD
LELDTIPASLTDDAEVKLRDPNPEVNEEKRKSARKKEFIMAELLQTEKTYVRDLQECLET
YLWEMNSGAEEIPPGIAGKEHVVFGNMQDIWDFHHNIFLKELVNYEQLPEDVGHCFVTWA
DKFHIYVDYCKNKPDSSQLILEHAGSFFDDVQQRRGLANSISSYLIKPVQRITKYQLLLK
ELLSCCEEGKGEIKDGLDVMLSVPKRANDAMHLAMMEGFEENLEVQGELILQDSFQVWDP
RSLIRKGRDRHLFLFEFSLVFSKEIKDSAGRTKYQYKNKLLTSELGLTEHVEGDPCKFAL
WAGRTPSSDNKTAPNMEAKQEWIKNIREVIQERMTHLKGALKEPLHLPKAPALSKPRNNA
KRDGGEDGDSQGDGGSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFTAGCSTEMSV
STGQTVELLERPSERPGWCLVRTTERSPPQEGLVPSAALCVSHSRSSVEMDCFFGSGKEN
YTVSGPDGKTESVTNLQPQPSLNSLQSSSPGPKRSTNTLRKWLTSPVRRLSHGSSVKKLP
GNKQKKGEESRKSIDLGQPDPNQPDDIIDEESNLLSRTPSGMQSGGEEEQDEEAHNPLPP
PMEIIKDSSAQDDKSSSLLTSLQSSSEVPSAAELVSAIEKLVKTKMTLEPGAYPGFSPLS
PPEQTTAVQPRNPELEQRAKAMRGRMFVLNELIQTEKDYVKDLGIVVECFMKKIEEKGVP
DDMKGKDKIVFGNIHQIYDWHRDFFVGELEKCLEDHEHLPELFIKHERRLHMYVIYCQNK
PKSEFIVAEYDTFFDAIQQESQSRFTISDFLIKPIQRITKYQLLLKDFLKYSSKAGIDCE
QIEKAVDLMSQVPKLCNDMMNLGRLQGYEGKLMCQGKLLQQETFFVIEQDTGVLSRSKER
RVFLFEQIVIFSELLRKGSSTPGYQFKKSIKVCFLGLEESVDNDPCKFVLSCRGSSDRFT
LQAANVDIKQIWVRHIQDVLDAQSNFLSALQSPIEYQKEKGSSSSLNRNRSLSGNRPSVG
HHSRPSSAVGFGEKEAERGRTPIRVSTSNGGSTCFESRDFDGGCNGVSSTMSVSRDYSAL
KENEICVSQGETVQILATNQQNMYLVYRPANSQSPAAEGWVPGHILGPLTKPIKDSASTS
SFSAASLSWNTLRARKRAKDVSSLAVRGPENGLLRKPKEGGAAAPPDAHTSDESDCDDDL
DPNAGMQLLNPNFIQEVAPEFLVVLSDVVCAFGETVVLCCKVCGRPKPSVTLKGPDQNPV
TSNARFTIDIGDTGDILLKICNLMPQDTGIYTCVAVNDHGSASSSASIKVQGIPASPGRP
VAQEASSTAVMIHWPPPASSAHCAVSSYTVEYRQEDSLLWQQVASSREECVQIDALIPGG
HYQFRVRASNRWGVGPPSEPSNMITLPSSNSGYDGTGIQWKENFESTFSEMCEIGRGRFS
VVRKCLNKSTKKEVAVKFVSKKMQKKEQVAHEADVLRHVQHHQLVALLDTYESPTSLMLI
LELLEDGRLLDYLVAHDELMEEKVAFFVRETLEALQHLHTCRVAHLDLKPENILVDLRSP
TPGVKLVDLGDAVQLSAHRRYVHLLLGNPEFAAPELIRGTPVSVATDAWSVGVLAYVALS
GVSPFLDESPEETCVNICRLDFCFPDEYFRHVSQAARDFVSSALQQDPRKRPSATSCLQH
PWVGRGGAHGGEYSKTPLDTTRLATFIERRRQLNDVRPVTNIKALV
Download sequence
Identical sequences G3P0N1
69293.ENSGACP00000011154 ENSGACP00000011174 ENSGACP00000011154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]