SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011162 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011162
Domain Number 1 Region: 154-294
Classification Level Classification E-value
Superfamily Hypothetical protein c14orf129, hspc210 1.7e-28
Family Hypothetical protein c14orf129, hspc210 0.014
Further Details:      
 
Domain Number 2 Region: 970-1084
Classification Level Classification E-value
Superfamily TPR-like 0.00000000014
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 
Domain Number 3 Region: 1053-1173
Classification Level Classification E-value
Superfamily TPR-like 0.00000000285
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011162
Domain Number - Region: 15-100
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.038
Family Ubiquitin-related 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011162   Gene: ENSGACG00000008439   Transcript: ENSGACT00000011185
Sequence length 1276
Comment pep:known_by_projection group:BROADS1:groupI:7480872:7489908:-1 gene:ENSGACG00000008439 transcript:ENSGACT00000011185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRDGSSETDGGEDSNEQEVIVIQDTGFTVKIQAPGTEPFDLQVSPQEMVQEIHQVLMDRE
DTCHRTCFSLQLDGNVLDNFAELKSIEGLQEGSLLKVVEEPYTVREARIHVRHIRDLLKS
LDPSDAYNGVDCNSLSFLSIFTDGDLGDSGKRKKKGNELEQIDCTPPEHILPGSKDRPLV
PLQPQNKDWKPMQCLKVLTMSGWNPPPGNRKMHGDLMYLCMVTVEERHVSVTASTRGFYL
NQSTTYNFNPKPSNPSFLSHSLVELLSQISPAFKKNFTAMQKKSRVQRHPFERIATPFQV
YSWTAPQVDHAMDCVRAEDAYTSRLGYEEHIPGQTRDWNEELQTTRELPRKNLPERLLRE
RAIFKVHSDFAAAATRGAMAVIDGNVMAINPGEETRMQMFIWNNIFFSLGFDVRDHYREL
GGDAAAHAAPTNDLNGVRAYGAVDVEGLYTLGTVVVDYRGYRVTAQSIIPGILEREQEQS
VIYGSIDFGKTVVTHSKYLELLEKTSRQLKVHRHNVLNEKNEAVELCSSVECKGIIGNDG
RHYILDLLRTFPPDLNFLPVDGEELSPESQRQGFPRPHPHRLACLRQELIEAFVEHRYLL
FMKMAALQLMQQKANRDAKAGVPAITETAQAPSESNADTTPTQTAAPESPSKELEESIPG
LAQAKELAETLVAEDGSCIESQTDPKSREVVLNACKAVGSISNTSFDIRFNPDIFSPELG
VRFPDDSADDIHKQKQLLKDAAAFLVSCQIPSLVKDCLDHSALPMDGATLTEALRQRGIN
IRYLGTVLEFVDKTPAKAQLEHFYRIGISELITRCAKHIFKTYLQGVELSALSAAVSHFL
NCFLSSFPDAVAHLPPDELVSRRKSRKRRNRVPGGGDNTAWASLTPNELWKNIASEAKSY
YHFTLQCESVDQVVEKYGFQKTTLLREISVKTGIQILMKEYNFDSRHKPAFTEEDILNIF
PVVKHVNPKASDAFHFFQSGQAKVQQGFLKEGCELINEALNLFNNVYGAMHVEICACLRL
LARLNYIMGDHAEALSNQQKAVLMSERVLGIEHPNTIQEYMHLALYCFANGQLSTALKLL
YRARYLMLLVSGEDHPEMALLDSNIGLVLHGVMEYDLSLRFLENALAVNTKYHGARSLKV
ALSHHLVARVYESKAEFRSALQHEKEGYTIYKNQMGEAHEKTKESSEFLKYLTQQAVSLQ
RTMNEIYKNGSNASITPLKFTAPSMASVLEQLNIINGIIFIPLSQKDLENLKAEVQRRQQ
LQELGKSDDPTEDRPL
Download sequence
Identical sequences G3P0N9
ENSGACP00000011162 69293.ENSGACP00000011162 ENSGACP00000011162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]