SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011170 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011170
Domain Number 1 Region: 208-406
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.01e-52
Family DBL homology domain (DH-domain) 0.0000202
Further Details:      
 
Domain Number 2 Region: 406-523
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-30
Family Pleckstrin-homology domain (PH domain) 0.00038
Further Details:      
 
Domain Number 3 Region: 605-666
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000578
Family SH3-domain 0.0000918
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011170   Gene: ENSGACG00000008415   Transcript: ENSGACT00000011193
Sequence length 674
Comment pep:known_by_projection group:BROADS1:groupXVI:16584312:16593892:-1 gene:ENSGACG00000008415 transcript:ENSGACT00000011193 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GWILSRCCCCCYNNTENYTVSGPDGKTESVTNLQPQPSLNSLQSSSPGPKRSTNTLRKWL
TSPVRRLSHGSSVKKLPGNKQKKGGTGREESRKSIDLGQPDPNQPDDIIDEARTPSGMQS
GGEEEQDEEAHNPLPPPMEIIKDSSAQDDKSSSLLTSLQSSSEVPSAAELVSAIEKLVKT
KMTLEPGAYPGFSPLSPPEQTTAVQPRNPELEQRAKAMRGRMFVLNELIQTEKDYVKDLG
IVVECFMKKIEEKGVPDDMKGKDKIVFGNIHQIYDWHRDFFVGELEKCLEDHEHLPELFI
KHERRLHMYVIYCQNKPKSEFIVAEYDTFFDAIQQESQSRFTISDFLIKPIQRITKYQLL
LKDFLKYSSKAGIDCEQIEKAVDLMSQVPKLCNDMMNLGRLQGYEGKLMCQGKLLQQETF
FVIEQDTGVLSRSKERRVFLFEQIVIFSELLRKGSSTPGYQFKKSIKVCFLGLEESVDND
PCKFVLSCRGSSDRFTLQAANVDIKQIWVRHIQDVLDAQSNFLSALQSPIEYQKEKGSSS
SLNRNRSLSGNRPSVGHHSRPSSAVGFGEKEAERGRTPIRVSTSNGGSTCFESRDFDGGC
NGVSSTMSVSRDYSALKENEICVSQGETVQILATNQQNMYLVYRPANSQSPAAEGWVPGH
ILGPLTKPIKDSAS
Download sequence
Identical sequences G3P0P7
ENSGACP00000011170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]