SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011208 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011208
Domain Number 1 Region: 490-557,598-634
Classification Level Classification E-value
Superfamily Second domain of FERM 1.86e-18
Family Second domain of FERM 0.0079
Further Details:      
 
Domain Number 2 Region: 86-190
Classification Level Classification E-value
Superfamily PH domain-like 4.48e-16
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 
Domain Number 3 Region: 391-481
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000031
Family Ras-binding domain, RBD 0.074
Further Details:      
 
Domain Number 4 Region: 638-724
Classification Level Classification E-value
Superfamily PH domain-like 0.0000311
Family Third domain of FERM 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011208   Gene: ENSGACG00000008473   Transcript: ENSGACT00000011231
Sequence length 724
Comment pep:known_by_projection group:BROADS1:groupXI:5449613:5474517:-1 gene:ENSGACG00000008473 transcript:ENSGACT00000011231 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLQGVCWFLCCRQGFSLLGREYGEKEEEESFELRNKEDLTPNGRSPAEVTVSQPTLTAN
GTNGHTVSEVSEMKSLIIEKNKMGLEEEPELLVKGWLLREVRGNWIKQRRYWFALSQDSL
DYYSGPEKGARRLGTLVLTSLCSVIWPDKQTYKETGHWSITVYGRKHCYRLYSKHFNEAV
HWACAIQKIIDTKAPVETPTQLLIRDIEENKFNPEVVEHIYQHNPILKYTQGPLYAPLLA
FPYGSLEHTYHGGQGYGSVREEAVKLFNCLQQLESAREPVPIIQGVLQTCLDLRPLRDEV
YCQLVKQNSYTPDPYTAAHLRYWQLLTCMSCTFRPGPTVLKYLRFHLKRIQSQSPESEMD
NYASFISEALEKTKCRECVPSWEEIQMLMSRQEMLCTVHYPGPLSCQLYISSHTTANEVV
RMMQEKLGLQESKNTFALYEQNALWEQPVAGGALIADILTRFENLSAKESESSSQWKLCF
KLYCLLDADSISLDSIEYLFLYEQCHEMVVRGQLPACDEDLQALASLRLQCLMGDFSTHA
PCPPLDELFPGHRLEAQDCPTAQRFPTGLLAGTLWSHAATAAHKQKAEQDMRLRSRLKEE
AATVMGSILERWKGLAGYSCRDSMAAYLTIARQWSGFGCTLYEVDFYISSTGCFSQKLWL
GVAATSVSLYRQDEAEALESFPYGQICSYGVSDSNTFKITAGDRDLLFETTKQLTEIMQL
MNAY
Download sequence
Identical sequences G3P0T5
69293.ENSGACP00000011208 ENSGACP00000011208 ENSGACP00000011208

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]