SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011256 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011256
Domain Number 1 Region: 347-642
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-89
Family Protein kinases, catalytic subunit 0.0000000243
Further Details:      
 
Domain Number 2 Region: 3-133
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.71e-27
Family PLC-like (P variant) 0.000037
Further Details:      
 
Domain Number 3 Region: 238-296
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.39e-20
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.00055
Further Details:      
 
Domain Number 4 Region: 157-221
Classification Level Classification E-value
Superfamily Cysteine-rich domain 2.54e-19
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011256   Gene: ENSGACG00000008506   Transcript: ENSGACT00000011279
Sequence length 692
Comment pep:known_by_projection group:BROADS1:groupXV:5772981:5787827:1 gene:ENSGACG00000008506 transcript:ENSGACT00000011279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRFNGYLKLRIGEAVGLKPTTFSLRHSVIFNKAPATMDPYIMVKVDDLKIGQTLTKQKTN
TPTFNEEFCLNVTDGKQIEMAVFHDTPIGYDDFVANCIVPFESLMETSNTGETFDGWMDL
EPEGKVYVHITLNGSFTDDDAIVKERKSFKQFTRKRQGALRRKIHQVNGHKFMSTFLRQP
TFCFHCKEFIWGVFGKQGYQCQVCTCVVHKRCHQHVVTTCPRMKKPAKEQQPINPGFSIN
IPHMFNVHNFKSPTFCDHCGSLLWGIVKQGLHCKICKMNVHIRCKGNVAPSCGVNSVELA
SKLSEMGLQAGGLSKRNSVQAQSQMRAPTERRESTESQQQTPRLGISDFTFLQVLGKGSF
GKVMLARLNIKDQVFAVKVLKKDIILQDDDVECTMTEKRVLSLACCHPYLTQLFCCFQTP
DRLFFVMEFVNGGDLMFHIQKSRKFEEPRACFYTAEITSALIFLHNKGIVYRDLKLDNVL
LDKDGHCKLADFGMCKEGIFDGITTGTFCGTPDYIAPEILQEMLYGPSVDWWALGVLLYE
MLSGHAPFEAENEDDLFESILNEDIVYASWLSAEAVNILKALLTKNPARRLGCVASGVGE
DAVTSHAFFADIDWEKLNRREMEPPFKPRIHSPETAEDVNNFDPDFTQEAPTLTPIDEPL
IPSINQEFRNFSYTSPELLERTVPSGSTMLSH
Download sequence
Identical sequences G3P0Y3
69293.ENSGACP00000011256 ENSGACP00000011256 ENSGACP00000011256

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]