SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011292 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011292
Domain Number 1 Region: 1350-1527
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.09e-45
Family DBL homology domain (DH-domain) 0.0000364
Further Details:      
 
Domain Number 2 Region: 1537-1651
Classification Level Classification E-value
Superfamily PH domain-like 3.91e-36
Family Pleckstrin-homology domain (PH domain) 0.00036
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011292
Domain Number - Region: 653-811
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00122
Family CRAL/TRIO domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011292   Gene: ENSGACG00000008538   Transcript: ENSGACT00000011315
Sequence length 1720
Comment pep:known_by_projection group:BROADS1:groupXX:9902094:9914812:-1 gene:ENSGACG00000008538 transcript:ENSGACT00000011315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QDTESLDSCIQSTLSALYRPFSATAATVLWQLFSVVERQYRGDGLRCLIDFLLPAKRILQ
IIQQETYVRFRGLLFYHEGWPLCIQEKVVLQLAPLHKVRLKQGDFYLQIVPLGRKTAKLV
IKCLSVSGQAIAEVTVAESMYGSVFTAEFLQNVTRERNLHPLQNCLLTTGTAVYRTPWKN
VVHPLFVSSTADAIMQARCSRGGFRGHLSTCSTSGSTGTLDSHRSSRESLHSQGADSIFS
EATSPNGNHAEPCGENHGVASHGTTIERVSTEECEIRGEDSGGRERGPGSKTLSFSTDLS
NPGPQRRLPRDSVAFESRRLFRKSYMEALQNPMSLGSSSESILEESPEAGAGLRDGSVTP
GSSPDTRSSSREHLSRRLGTRSWLSGDDSRPSTPLLYLQRGLRSAERRADRRSKSLERTN
KAGQPHAVYFLARSVYRLVRSDVRVPPIRNHNVLSKRLRTDYFHLNVSNTHHPFLRLPQR
GILFSAAVKQVSHNNISKATKDPVNQPQAPQHPTNFSQSNTPTCLIHKNEHKRNKLLIET
QQRSHNSALCGERRCSAGLCVLSGTVSGCLRNRMCVRSIPINRARDKVCPPFILISTGQR
VDTISSESRRHRLSVEEPCSPKATNGTAIRPASASGSYNESLSATPKLVSEVNEELLASG
ALILPGNRDRGGRAVLQVCTRAQVWAGESCTVSDLTCLLGYYYSTLRKERRDQGLTVVID
SRRQQPVPALLSSLSELQASAPNALYTVLFLVDKETATKSERDIGVQTETMSSLKALLKH
IDQNQLTRDLEGNFHYDHNHWIHFRQKIDPFASSCSESISSLQESISSLSSSGNPKTSKE
VSEVLEQQRHLMKSVLEDTRLNRLRLEGGTVLARIRKEEACDNENYRDAFDTLNALYNQV
DEEVHKLVILSNKSQKRLESLLEVRMFEEQTQQIKLWFSVEGEKQLTPLESLTPSVAKVK
EMRESLDQFLEESVKQQRHGLQLVKESPESLPGSVLLDFKQHLGSILSRVERRKAKLDIL
TNLYEFYDSANQWTEHCQDYFAHLSLDTSGVGLLPSVVQNLQDYYTEASKFSTDNFSTLN
SMVLSLESPQQLQQWNTVWHKCQQTKQQLEETLARAMTAAPNSPAVDAAAPLETEAESQT
AATQQHGAKACVLLPAVITTLSFEDSKPQSAGPFSKSPSSSIASSSHFTFPAECDGKLRQ
SPSMFDDTDSDCTIDSTTSCQSEPVYSGAARLRKQPMKKIMKKTMSYELTARDNGHSDVC
HIHGYTGVYIKGLEVANNVSAEKKLQRPDILSPALGRSRSMSTPSRIHSRHSDGEGKKQC
SLFCLSCIVYNGMMLRKQAMTILNSAIGNKVQHIMDEMISTEREYVRSLGYIIENYFAEM
ERLDLPQDLRGKRSIIFGNVEKLWDFHSQYFLKELESCAHSPLSISSCFLRHEDQFGMYA
LYSKNKPQSDALLSSHGNEFFKNKQLELGDKMDLASYLLKPIQRMSKYALLLKDLIKECS
QSQEQELSDLRTAEEMVKFQLRHGNDLLAMDAIRGCDVNLKEQGQLRCQDEFIVWCGRRK
YLRHVFLFEDLILFSKTKKIEGGYDFYIYKQSFKTAEIGMTENVGDSGLRFEIWFRRRKS
QDTFILQASSAEVKAVWTAIIGKILWRQALRNRELRMQEMVSMGIGSKPFMDIKPSDAAI
SDRAIDYIMKGTDHSTSFKRPHSTISNSSTSSSSSQSSSS
Download sequence
Identical sequences G3P119
ENSGACP00000011292 69293.ENSGACP00000011292 ENSGACP00000011292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]