SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011318 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011318
Domain Number 1 Region: 329-724
Classification Level Classification E-value
Superfamily Oxysterol-binding protein-like 4.45e-117
Family Oxysterol-binding protein 0.001
Further Details:      
 
Domain Number 2 Region: 1-103
Classification Level Classification E-value
Superfamily PH domain-like 1.21e-23
Family Pleckstrin-homology domain (PH domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011318   Gene: ENSGACG00000008560   Transcript: ENSGACT00000011341
Sequence length 724
Comment pep:known_by_projection group:BROADS1:groupXIII:8599301:8627598:-1 gene:ENSGACG00000008560 transcript:ENSGACT00000011341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KGWLFKWTNYLKGYQRRWFVLSNGLLSYYRTQAEMAHTCRGTINLATAHIDTEDACNIVL
SSGGRTYHLKASTEVERQRWVTALELAKAKAIRMMNDQSDDSGDEEPTSQSGRSELQGTL
KILVSKLDDLSTCNDLIAKHGAALQRSLSELEGLKVPVEGGEKIKAVNERATLFRITSNA
MINACRDFLELAETHSRRWQRALQYEREQRTHLEETIEQLAKQHNSLERAWREAPALAST
TPSAPAASKGRSERLHKEEASDEDEDTEYFDAMEDSPAFITVTATDNTEHRRSQSNLSGA
SGGQPTDWNQDDHKLQPRRQRRTQVPDKPNYSLNLWSIMKNCIGKELSKIPMPVNFNEPL
SMLQRLTEDLEYHELLDKAARCDSSLEQMCLVAAFSISSYSTTVHRTAKPFNPLLGETYE
LDRREEFGYRSLCEQVSHHPPAAAHHVISQRGWTLWQEITIASKFRGKYLSIMPLGAIHL
QFHSSGNQYVWRKVTSTVHNIIVGKLWIDQSGDIEIVNHRTKETCQLKFSPYSYFSRDVP
RKVTGVVADSGGQAHYVLSGTWDDKIESAKVVHSSRGGSGSEGKQKTVYQTLPPKLLWKK
YPLPENAENMYYFSALALTLNEQEDGVGLTDSRLRPDQKLMEEGRWDEANSEKQRLEEKQ
RAVRRRREAEASDAVDEGKEYEGYQPLWFHQRRDSVTGDTNFVYKGGYWEAKERQDWSMC
PNIF
Download sequence
Identical sequences G3P145
ENSGACP00000011318 ENSGACP00000011318 69293.ENSGACP00000011318

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]