SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011325 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011325
Domain Number 1 Region: 327-426
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.72e-31
Family Ras-binding domain, RBD 0.0036
Further Details:      
 
Domain Number 2 Region: 460-574
Classification Level Classification E-value
Superfamily PH domain-like 3.01e-17
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011325   Gene: ENSGACG00000008565   Transcript: ENSGACT00000011348
Sequence length 735
Comment pep:novel group:BROADS1:groupXVI:17218776:17235905:1 gene:ENSGACG00000008565 transcript:ENSGACT00000011348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SQQRSSKTVDHQAELSSDKEDQDLDKMFGAWLGELDKLTQSLDESRPEEPPQRKAPLRQD
TNMANFSYRFSIYNINEALNQGENVDLDALMADLCSIEQELGTVNAKPNSAGGMARLGLT
DAKVRQKPPAGRRASPAGTIRVPAEHHGRAALASNFSLDDITAQLEKASLSMDEAARQTS
SHSLTSASSRHHRRTGSVGTVSEHEARSIVHSSRSSATSASGASVNSASSMDSLDSVLCS
DEPEVFLTISQGQNVLKNKLKNICFGKNEKLFKNVMEIKAKNLKHSYLDRETSLILRNIA
GKPCHLLTKEEQAAKLKADNIRVALEKIKEAQVKKLVIRVHLSDESSKTMMVDERQTVRQ
VLDSLLEKSHCGYSPDWSLVETINELQMERIFEDHENLVENLQNWTRDSQNRLMFTERIE
KYALFKNPQNYLLGRKETCEMAERNKEALLEGQECFGGSTVSVPEMEGVLWLKEDGKKSW
KKRYFLLRASGIYYVPKGKAIVQASRDLVCFLQLDHVNVYHGQDYKSKYKAPTDYCMVLK
HPQIQKKSQYIKYLCCDDVRTLQQWINSIRIAKYGKQLYINFQEAMRRTEAAYDWSSLSS
SSIKSGSSSSLPESQSNHSSQSDSGVSEMTSSGHTRSQSAVSSIFSDAWRRGTQGEESAD
KQHDAVRRAALAAASVSSPGPSSLTLKPHFLEDLNRTLKRKSVSRHGSLTSSHLISSCKM
EPAGTMDDMALLPPP
Download sequence
Identical sequences G3P152
69293.ENSGACP00000011325 ENSGACP00000011325 ENSGACP00000011325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]