SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011361 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011361
Domain Number 1 Region: 255-451
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000373
Further Details:      
 
Domain Number 2 Region: 71-177
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-19
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011361   Gene: ENSGACG00000008601   Transcript: ENSGACT00000011384
Sequence length 456
Comment pep:known_by_projection group:BROADS1:groupXVI:17256258:17262625:-1 gene:ENSGACG00000008601 transcript:ENSGACT00000011384 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVHMRMKSPQSSADRLSQSKSMVLQESDLPKNPISRHRRNQSQHNVLAAGEGLSAFEPYV
ELEGEHLNVAKISQSGKKQRKNWNVMWSVLTPGQLRFYKEKQETPLKPGSKTDVVQLCGA
VIAWTTDKSSRKNVFQVTTNTGSEYLLQTDSYSSADKWYNGIRKAIDNSTKLPLRRSNST
EYLPRHSSLPAYASASPNTKPRNAVHRRSINMFSSSKLKHSASDSADKSGVKNRLKKFIN
RRPSMKTLKEKGLIKDRVFGCHLLTLCEREGTTVPRFVQICLDAVEKVSGLDADGIYRVS
GNLATIQKLRFIVDQEEPLDLDHSQWEDIHVITGALKLFFRELPEPLFPFRFFTPFVEAI
KIKESKLKVQAVKKLIQELPKPNRDTMKLLFSHLHRVLDFSKKNLMSTQGIGIVFGPTLM
WPELDTGNMAVNLVYQNQIVEFILIESQEIFNLDGK
Download sequence
Identical sequences G3P188
ENSGACP00000011361 69293.ENSGACP00000011361 ENSGACP00000011361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]