SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011374 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011374
Domain Number 1 Region: 1-113
Classification Level Classification E-value
Superfamily PH domain-like 3.69e-40
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000134
Further Details:      
 
Domain Number 2 Region: 327-365
Classification Level Classification E-value
Superfamily Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.000000000000968
Family Vasodilator-stimulated phosphoprotein, VASP, tetramerisation domain 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011374
Domain Number - Region: 192-201
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00706
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Domain Number - Region: 177-220
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0314
Family beta-sandwich domain of Sec23/24 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011374   Gene: ENSGACG00000008613   Transcript: ENSGACT00000011397
Sequence length 368
Comment pep:known_by_projection group:BROADS1:groupXV:5827640:5855519:-1 gene:ENSGACG00000008613 transcript:ENSGACT00000011397 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEQSICQARASVMVYDDASKKWVPIKPGQQGFSRINIYHNTANNTFRVVGVKLQDQQVV
INYSIVKGLKYNQATPTFHQWRDARQVYGLNFASKEEATTFSNAMLFALNVLSSPDGGGP
VVQRQNGPSSEESEAQRRMMEQHQMQAHKERERRTSGSGEGGPPVSAGHPSFCSVAPPPA
TVPAPMAGPPAPPPPPGPPPPMAVPPPMPPPLPAQHQPSGLAAALAGAKLRKVQRDESSP
PGSSGKSDSNRSSGGSGGGGEGLMQEMNALLARRRKASEKPDEDDSGGRGPGQQNSTDAM
KKPWERSNSTDKSSLVSRVRPIGSTSESDTEFDRMKQEILDEVVRELHKVKNEIINAIRQ
EIGRISTS
Download sequence
Identical sequences G3P1A1
ENSGACP00000011374 69293.ENSGACP00000011374 ENSGACP00000011374

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]