SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011409 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011409
Domain Number 1 Region: 86-406
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.42e-74
Family Protein kinases, catalytic subunit 0.0000073
Further Details:      
 
Domain Number 2 Region: 1403-1474
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000994
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.013
Further Details:      
 
Domain Number 3 Region: 1504-1625
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000182
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011409
Domain Number - Region: 449-618
Classification Level Classification E-value
Superfamily Tropomyosin 0.00543
Family Tropomyosin 0.012
Further Details:      
 
Domain Number - Region: 606-774
Classification Level Classification E-value
Superfamily Tropomyosin 0.0209
Family Tropomyosin 0.0013
Further Details:      
 
Domain Number - Region: 1255-1351
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0262
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011409   Gene: ENSGACG00000008628   Transcript: ENSGACT00000011432
Sequence length 2081
Comment pep:known_by_projection group:BROADS1:groupXVII:7986609:8018375:-1 gene:ENSGACG00000008628 transcript:ENSGACT00000011432 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKFKYVNQGSMTTLPSSADPLTIRSSRLNQVFQGRVSLSGQRGECSLGREEFLEALLLL
YEECVSPELMKIHHVAHFVHKFSEVVSELRAMQPGADDFELRAVVGRGRYGEVQVVREKA
TGDVCALKVMDKEVLRSQGNVVFHEEERRILGLNSSPWIPQLLYAFQDKEHVYLAMEYLP
GGDLMSLLNRYEDQFDESMSQFYLAELVEAIHAVHQLGYVHRDVKPENVLIDRTGHIKLA
DFGSAATLTANKTVLVPTVPAGIPDFLSPEVLAASNGGFQSTYGVECDWWSLGVMAYEMI
YARSPFSGATSAKTIHNILNFHRFLKLPEEPRASKPFIDLLHSLLCAAKERLDFQGLRCH
SFFSSVDWNHLRQVLPPFVPALHAEDDTSNFEEPEQAAPRPAPAAQRGALPAGFQGQDLP
FLGWFFSRALTTLAKTESVSAGLNSPAKTNSIEKKLHLKSRELQETQDKCHKMEQEISRF
QRKMTDLESVLHQKDVELKASETQRNVLEQDLATYITECSSLKRSLEEARVEVSREDDKA
LQLLHDIREQSNKLQEIKEQEYHAQLEEMQVTIRQLEEDLSAARRRSDLYESELRDSRVT
SEELKKKAVEYQQRIQKAKEQGKADVEELLSKLEKTNSEQQVKIQELQDKLSKAVKASTE
ATELLQNVRQAKERLERDLERLRGKTDSSDTLKRRLRETEEGRKTLENQVKRLEMVERRE
NKLKDDIQTKSQQIQQMAEKILELEDNLRDAQSTAQRMETQLVQKEKLYDDKIKVVLEAQ
IKEDLADKESLEARRAQQEEESRENCKLISEQKATLNAMDSKMKNLEQRISELSEANKLA
ANSSIYTQKNMKAQEEMISELRQQKFYLESQAGKLEAQNAKLEEHLEKMSQQEQTKRTRL
LELESRLREMGLEHEEEKMEIKRQVSELTLSLQERESQISSLQAARLALESQLQQAKTEL
EETTAEAEEEITALRNHRDEIQRKFDALRDSCSVITDLEEQLTQLSQENAELNRQNFYLS
KQLDEASDEREDQLQLSQEVDRLRREVADREMHLNNQKQNIETLKTTCSMLEEQVVELES
LNDELLEKERQWEAWRGALEDEKSQAERRTRDLQRLMDNEKQNRLRADQRSTESRQAVEL
AVKEHKAEIMALQQALKEQRLKAESLSDTLNDLEKKHAMLEMNARSLQQKLETERELKQR
LMEEQGKLQQQMDLQKSHIFRLTQGLQDALDQTDMLKTERTDLEYQLENIQAVYSHEKVK
MEGTISQQTKLIDFLQAKMDQPTKKKKGIFGRRREDVGTTTNGALAPQAQPVVPMQYGDM
KLAFEKERSRCADLEDALQKMRIELRSLREEESAAHFKAQEHVAPSTPAQARHQILMSAI
VKSPEHQPNPSSLLNPATRCKETSTPEEFGRRVKERMHHNIPHRFTVGLNMRAAKCAVCL
DTVHFGRQAATCLECHTLCHPKCSPCLPATCGLPAEYATHFSEALCREKANSPALQVKEA
SGHVRLEGWMKQPRNGKRGQQGWERKYVVLDGTRVSIFDTEPREDYIKMEEEFELCLPDG
EVTVHGAVGASELINTAKSDIPYVLKLESHPHTTCWPGQSIYFMAPSFPDKQRWVAVLES
VVAGSRGSRDKVDSDAKLLGNSLLKLEGDDRLDINCTLPLTDQIVLVGSEEGLYALNVIK
NSLTHIPGLTSVFQIQILKELDKLLMITGEERALCLVEIKKVKQSLSQSHLPAQPDLNPF
IFETVKGCHLFSSGKIDNGICICAAMPNKITILRHNESLNKFCIRKEIETSEPCSCIHFT
GYSIIIGTNKFYEIEMKQYVLEEFLDKNDVTLASAVFAASSHSFPISIIQVTTAPQKDEY
LLCFHEFGVFVDAYGRRSRSEDIKWSRLPLSFAYREPYLFVTYFNSLDVIEIQGHAALGP
HSYAHLDIPNPRYLGPAISSGAIYLASSYQNKLRVICCKGNLIQSQEGAGDLQRNGSGRS
PNKRGPPSYNEHISKRLAANPHVHSDPGTPHRYREARTEFRRDKSPSRPLEREKSPGRML
ESRMAGSPGRAMADAERQRLHTGSGRTPINPVNKVWDQSSV
Download sequence
Identical sequences G3P1D6
69293.ENSGACP00000011409 ENSGACP00000011409 ENSGACP00000011409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]