SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011416 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011416
Domain Number 1 Region: 20-250
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.41e-73
Family Calponin-homology domain, CH-domain 0.000000933
Further Details:      
 
Domain Number 2 Region: 2949-3076
Classification Level Classification E-value
Superfamily EF-hand 6.35e-45
Family EF-hand modules in multidomain proteins 0.00000437
Further Details:      
 
Domain Number 3 Region: 3077-3173
Classification Level Classification E-value
Superfamily EF-hand 1.13e-36
Family EF-hand modules in multidomain proteins 0.000014
Further Details:      
 
Domain Number 4 Region: 1928-2085
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-24
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 378-536
Classification Level Classification E-value
Superfamily Spectrin repeat 8.51e-22
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 3153-3241
Classification Level Classification E-value
Superfamily RING/U-box 1.65e-21
Family ZZ domain 0.0092
Further Details:      
 
Domain Number 7 Region: 503-640
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-20
Family Spectrin repeat 0.0026
Further Details:      
 
Domain Number 8 Region: 2388-2546
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 9 Region: 1467-1619
Classification Level Classification E-value
Superfamily Spectrin repeat 1.15e-16
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 10 Region: 2614-2739
Classification Level Classification E-value
Superfamily Spectrin repeat 7.92e-16
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 11 Region: 2765-2904
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000018
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 12 Region: 1100-1209
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000276
Family Spectrin repeat 0.0045
Further Details:      
 
Domain Number 13 Region: 2911-2948
Classification Level Classification E-value
Superfamily WW domain 0.000000000593
Family WW domain 0.00025
Further Details:      
 
Domain Number 14 Region: 1578-1720
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000533
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 15 Region: 1201-1314
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000202
Family Spectrin repeat 0.004
Further Details:      
 
Domain Number 16 Region: 965-1052
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000038
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number 17 Region: 2092-2201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000016
Family Spectrin repeat 0.0046
Further Details:      
 
Domain Number 18 Region: 685-790
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000772
Family Spectrin repeat 0.0094
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011416
Domain Number - Region: 1280-1414
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000393
Family Spectrin repeat 0.0072
Further Details:      
 
Domain Number - Region: 2161-2278
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00115
Family Spectrin repeat 0.012
Further Details:      
 
Domain Number - Region: 2338-2402
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0101
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011416   Gene: ENSGACG00000008623   Transcript: ENSGACT00000011439
Sequence length 3529
Comment pep:known_by_projection group:BROADS1:groupXVIII:8022722:8135117:-1 gene:ENSGACG00000008623 transcript:ENSGACT00000011439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
WSTLFITAAGASSMWDKSPLKWRKDEHDSVQKKTFTKWINAQLSKTGKTPINEMFSDLRD
GKKLLDLLEGLTGTVLTKERGSTRVHALNNVNKVLQVLHQNNVDLVNIGGTDIVDGNHKL
TLGLIWSIILHWQVKDIMKDIMSNLQQTNSEKILLSWVRQCSRSYPEVNVLNFTTSWADG
LALNSILHHFRPNAFGWDEVVGLSPVERLEHAFTVAKDQLAIERLLDAEADVAVQLPDKK
SIIMYVTSLFAVLPKDVTMEAIREVETLPRKYKVESEKFGSGLSAQNVQMEEAGSSPRPE
TPSTLTETEGELEGSLLEVDLDSYQTTLEEVLTWLLSAEDALHTQEEVSDDVEEVKEQFH
THEVFMMELTAHQSSVGNVLQAGNQLIAQGNLTDEEEEEIREQMCLLNSRWESLRVASMD
RQARLHEVLMDLQQQQLQQLSDWLSRTEERIKKIETEPPAKDLELYREQLEQHKELQNDL
EAEQVKVNSLTHMVVVVDENSGESATAALEEQLQSLGERWAAVCRWTEERWHKLQEVFMV
WQQLLSDQSLFHAWLEEKEEALSEIQTSNFKDPSEMNINVRQLAILKEDMEKKRRTLDQL
SDAGQDVISLLRSPEAGATIGNNTEELAHRWDNLVQKLEDSSFPKVMEAVTDAGMTPVEE
QDAVDAAAASLADQELAPPAPPKKRLVETDAEVRQLFEKKLSDALSWTKTWKTSAQALAS
THPDATPNTPDLQDTLKGLELDFNAKEATVSQVIQDGRVLMDQLEREGVCVDAVRADINL
TQTEWDACARELQAASERVHTQCRVAALSAELADLDRALEEHDRWLDATSAGEKRDEAEF
RSLSGECQSRLVGVAASSPRLEQLSAEAGSLGAMPSLRDNMVVVAAHHASTLQRLQSREQ
EVNTALTSCEANRVSNQVDGLKARLATLREGIVDIATGEDAVESAQGLCLEIEQTQQASD
PTELQRWSRLSSRAREELGTLQCILGSMKDNQVRLGEVESWLDAVQELLSHDATSLGGKE
TVQEELNQCQEYVNEMESVEGSLKQMGENVSAVQGAAVPGLAKWGQEKLDECRGKWDTLG
KQLLRHQERAAENQERQVNLRKDLAEMQEWMTQVDEEFLMRDYEYKSPEELEASLEEMKR
AKEDVLQKEVKVKILKDSINLLVSRTSPPVGRGSEELTSELEGVLANYQKLCDRFKSKCH
TLEEVWSCWMELLQYLDMEQGWLNTLGEKVQASENLAESTEAVTEALEGLEGALRHPGDN
RTQIRELGQTLIDGGILDELISEKLEAFNSRYEQLNQQAVNRQVGLEQQLQTLKENEQAL
QKLQESLSQLDQTLTSYLTDRIDAIQLAQEAQTIGAEIAAHEVTVEEMRKRNVANLPPAA
TDGKAARGGTMLDHLQRKLREISTKYQLFQKPANFEQRMLDCKRVLDGAKAELHILDVTD
VDPEKLQSHLSGCMKLYKLLSEVKLEVETVIKTGRQIVQKQQTENPKAMDEQLTALKLLY
NDLGAQVTEGKQDLEKALSLSQKFQKESAVLEEWLTTNEAELQRKNGCGDMPADIDAEIA
WANGLLKESERRKVELTSLTETSAGLQTLVEDSGPPLEEKLGGINEAWGRVRTWTEDWLS
AVLSHQNEVEIFDENLAHISTWLYQTQIHLDEAERLGPTEREKVVQSMLEELEDISLRVD
NVRDQAVILMTSRGPACRDVVEPKLAELNCNFDKVSQHIKTAKMMSCLESGRVEFNQQVP
QKVIRSPESPSRTLVSSELTDLQAELHDTLRALQRDPTNVLDDDEMDEEKASVEVLLRRG
DELLQQTSDEGQREELRLLLLRLQSQYSAHRELRVLRLRQAEVSAETPAHIFTKQIRAEE
MMSSVQRSGAPPLGSSDYLLDINKVLLAMADNELLLNSTELSGGLYEDFSSQEDTLRSIK
ESLECVGEQVTGIHERQPDVVRDASPAEVAQIGDALTQLNAEWDRLNRMYNHRKGRFDRA
VEEWRQFHCDMNDLNQWLTDTETLLSQSICPDGQLDLNCAKQHQEELEEGLVSHQPVLAE
LTHSGEQIIGHLSSPDGSLLEEKLDSLAQRWRAVNRHVLERQRRLAGGDQALSDLVRRRE
TLAAWLQQAENAVRSLPVIATDSDLRELKVLAEEMDAHNERLGWLNKHAPQILTGPSVSS
QNRDQHVGKLRAINLSWSKVTQELLEKVGEVENNLRSHAQFQDRMNRLTDWIVVTQQTIF
TRGLSPGQAQDLEASMKDRKKDLEDLLAHSIELQRQQQLLPQEKGEVEQLAGDWKALDCR
LRETLQPPVSPWTQQQHFVQHQPLVSPVPSAVQMASLVSEDPHHQTPHTPESVAPTDLNE
TATELANWLVLITQMLKSNIVTVGDTEEIRATMGRLQVTKNDLEQRHPQLEDIFTLAQNI
KNKTSNLDVRTSITEKLERVHSQWDSTQHGVEARLQQLDNMIGHSNQWEEQRKEVNAVIG
HNEGRFHNLLQQSADPLTKQLADNKAFLQDLGRGQAAVVAFNELSSHLLREYSIDDTRRI
KEVTDKHNAAWNGINNRASDRHAHLDTELKGLQMSLRELESLLKWLQEAETTVNVLADAS
HREDLSRDSAHAKELRRQLEDIQAEIDAHNDIYKSVEGNKSKMVKALGSSEEAVFLQHRL
DDMNQRWSDLKAKSANIRAHLEASAERWSRLLGLLEELWRWICVKDEELAKQMPIGGDVP
TLLQQQNHCTILRSELKEREYLVISTLDQARMFLADQPIEGPGEPRKNLQPKTDLTAEEK
ARGLARAIRKQTGEVSERWERLKGHMGGWHNQVERALERLQELQSSMDQLDLRLTRAEEV
KATWQPVGDLLIDSLQDHIDKTVTFREETAPLRQDVRDVNELSAELTPLDIQLSSTASRQ
LDQLNMRWKLLQVAVEDRLKLLQEAHRDFGPSSQHFLSTSVQLPWQRAVSQNKVPYYINH
QIQTTCWDHPKMTELYQSLVADLNNVRFSAYRTAMKIRRLQKALCLDLLDLSVAQNTFEQ
HKLTNNSQLLSVPDVINCLTSIYDGLEQEHKDLVNVPLCVDMCLNWLLNVYDTCSGRSGK
IRVLSMKIGLLSLSKGHLEEKYKYLFSQVASAGDTCDQRQLGLLLHEAIQVPRQLGEVAA
FGGSNIEPSVRSCFQHVTNKVELEPRQFVDWMRLEPQSMVWLPVLHRVAAAETAKHQAKC
NICKECPIVGFRYRSLKHFNYDVCQSCFFSGRTAKGHKLNYPMVEYCTPTTSGEDMRDFT
KVLKNKFRSKKYFAKHPRLGYLPVQTVLEGDNMETPVTLISMCPEQYELSQSPQLSHDDT
HSRIEQYAIRLAQMERSNGSLPTDSSSATGSMDDEHALILQYCQTLGGEGSPPSSQPQSP
AQILQAVEREERGELERIIVRLEEEQRSLQKEYEQLREQHGQRGAPAGSPWDPEGPDEAD
LLAEAKLLRQHKGRLEARMHILEEHNKQLESQLHRLRQLLHQQPEMDSRVNGVSSLNVQD
RGPLAENSGSDEMLESHHSSSDLADVMEQINNSFPACSPSSLSSRPQVR
Download sequence
Identical sequences G3P1E3
ENSGACP00000011416 ENSGACP00000011416 69293.ENSGACP00000011416

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]