SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011428 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011428
Domain Number 1 Region: 2032-2338
Classification Level Classification E-value
Superfamily BEACH domain 7.72e-119
Family BEACH domain 0.0000000147
Further Details:      
 
Domain Number 2 Region: 2454-2734
Classification Level Classification E-value
Superfamily WD40 repeat-like 3.66e-31
Family WD40-repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 1919-2006
Classification Level Classification E-value
Superfamily PH domain-like 2.01e-21
Family PreBEACH PH-like domain 0.006
Further Details:      
 
Domain Number 4 Region: 603-635,672-765
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000000528
Family Laminin G-like module 0.067
Further Details:      
 
Domain Number 5 Region: 984-1222,1258-1323
Classification Level Classification E-value
Superfamily ARM repeat 0.00000312
Family GUN4-associated domain 0.089
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011428
Domain Number - Region: 265-362,398-444,490-546
Classification Level Classification E-value
Superfamily ARM repeat 0.00023
Family Mo25 protein 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011428   Gene: ENSGACG00000008637   Transcript: ENSGACT00000011451
Sequence length 2748
Comment pep:known_by_projection group:BROADS1:groupXX:10004676:10032377:1 gene:ENSGACG00000008637 transcript:ENSGACT00000011451 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PKGGGMASKERLYELWMSYYTKKDVGCLQQWLEAFVASFETLIDVHSLQPRRPEECSSEV
PLLPTEVMVFLGGLLRQSAEHLSEAADPASIPPHPLLLIKFFIIICRNMENIDQEKTPDF
VFETIKLLNFCLDQLKKGRGEPSSLQVLVRYGLVLCESLFDPYQTWRRHLAGEVVSSLEK
NKYKFFPLALPEELPALLHETLQESKQIPELLTLRLVHLQGAVVSGGKNNGLRSITPHAV
DDLFSVLRAWCYRTSPEPKSTGLPRLTLQCLTAMIHLLHSSSPAERQVEIKTILESYFQL
LNWNRPLISEQLESQSWEDSLISLQRQMLTAVPEILQCSDRPVLQAVFLNNNCFEHILRL
VQNSKLFQSTMHSLEREVVSDPTTCLLSEVEVDQVLVKGSDSITVHALGVLTAIMSNSPS
AKEVFKERIGYSQLFDVLKSQGQPSKRLLQELMNMAVEGEHAHAHHLGISNEQPLLLLLQ
WLPDLSGQRDLQLLVAQWLAMVCGGSLSCRTVAVEADMVGGLLQVLSQPQNLDRQSADTL
LGLLKDLGSLCLRPEELKSLLGLVRVDQENGVVVGKVHPYCARVIQVLSAMAAREGQDSA
LQYFDLTPPMAGIMVPTVQRWPGSGFAFHAWFCLNMKFSNNRKPFATVSTGAQHDMGKGP
RRKQLYSFFTASGTGLEAFFTMEGILVVAVCTKKEYMTVTLQEHPLADSCWHSVAIVHIP
GRRPFGQNLVTIYVDGEQRKTAQLRFPSFSEPFTSCCIGSAGHRTTTTTTSPHLPASSSS
NPSAEFAFPDHGHAFSRSQSFPATFAGGRRGALGDAPVHTIPAGLQDTEWGTPTSLDGLL
GTAFICHEALQQTQTKVLHAAGPNHVSLFKAEGELSDLNGKLLLYYTPQAFKGQICLDLS
PNHQYDGRFTGHRVVNWDIKDVVNVMGGIGVLLPLLEQVCEAEPVHSGSQELSDHEPTAP
RNPAALLLPLNKSAEERLERNSIAAFLLMVKNMIHHHPVNQESLLHCNGPSTIGAMLSKV
SDSMIDMNVLMACQLLLEQVFDEGNSPLLQQLYHHLLFDFRIWTKSHFSVSLAHVQYLAS
VINKGKQRVKRKYGVQYVLDTIRTFYSVDKDGSSLSEEKQTIQTSLFALLKDFLKSPTPE
DLHSVLAFILTVGEEKQAVRALDVLYELLRSSPPREQVQAWLLDWGVEQLYGLLLTPSFG
DEARERVFRVLYKILKSERVSERNKQRIKLKDFGYLGLVCLLDEVPVTMTTVRCLYEQVL
ATDATPNFRDLLAVVCLSHRGELSVRLDVCRKLFHLIYSNEDYVKQLARQPGWQDVLTKL
YVKEFYESHAASVAGSSTHSSFEPNYRPPLSPSSSTSNAVDIIKPVRDGGDYQPQSPFSN
PFYLELGSMGETGTHTPTGSSLTNTPSPLEQCKTFPLTRPRKSSSLSNVLDDTSYGTDPP
TGDTISNTSNPQQTPEEELCNLLTNIVFSVLWSRNGAETTEDVVWRERGQVFSVLTKLGS
SCQLVRPPDDVKRSLLEMMLESSLSDLREAQGVFLPFCPSLVRLLRLLQDFLFSEGTDNH
ALWSEKIFEGVVNLLDKLKAWHSTPGSPGNIELKEMAQIGLRIITGYIKQQHSQVCVMAY
VKLHSLLQTVMCLSWEEVCFLLGQLGAPLWPQGAVDGSGCGEAEIFSQLVPVVRTLLDQH
ADPVTLQKLLPNLPVTNGSPTFAQDLKAYCHTLEWQGFFQQQVQPTKEQYELDTFGRCHD
IMSNFWNSCFDDLMVTAFKRDKERSDSKSKFQEVIMDPYAKRVRIENNRYLSCQKQSSSQ
QGVVWQHWKALRRLLTSERGAWANKVQPEVKLKLSNAETYSKMRLKLVPNHNYDPHSEAS
ALRDNMGYSGADSPRSSEPLPLAVAKEAKVNDMEDDQLGEEDLVFLDNKVEGEDENQKEK
LVLSEDCELITIVAVVTGRLEVTTHHLYFYDGSSEKEETEEGIGFDFKRPLSQLREVHLR
RYNLRRSALELFFIDQSHYFINFKKKVLPGSNLTPPALQVRNKVYSRILGLRPPNLFYFG
SRSPQELLKASGLTQKWVCREISNFEYLMQLNTISGRTYNDLSQYPVFPWILSDYTSPIL
DLEDPSVFRDLSKPVGVVNPRHAQNVREKYESFEDPTGTVDKFHYGTHYSNAAGVMHYMI
RMEPFTTLHIQLQSGRFDCADRQFHSVAAAWQARMESPADVKELIPEFFYFPEFLQNMNG
FDLGHLQITQGSLTDVLLPRWASSREDFIKQHRKALECEHVSSHLHEWIDLIFGYKQRGE
EAVEALNVFYYCTYEDAAVGAVDLDAIANETERKALEGIISNFGQTPCQLLKEPHPPRMS
AQNASRRLARLDTVPPNIFEQLDKLRPFVEVVSDGLPLVQAVVPKSQTRSFIIQGSDILV
TVSSNGLIGTHSWLPHDKNFANYFTFTKDPTMTNPKTQRFLSGPFAPGVEISAQVLVVSN
DGRLLFSGGHWDCSLRVTQLGKGKLVGRICRHIDVVTCLALDLCGIYLISGSRDTSCMVW
QVLQQGGFSSGLSPRPVQVLCGHDQEVTCVAISTELDMAVSGSKDGTVIVHTVRRGEFLR
TLRPPGESCVPAKISQLQVGMEGHIVVQTSLEEGAYRKGKYSIHVYSVNGGLLSSFTVEE
KVTAVHLVSEHIILGTVEGSLHIRDLCSLKAAVAPLALKVPVRSVSVTKECSHILVGLED
GKLIVVGAGKPEEVRSGQLTKRIWGSTRRISQVSSGGTEYNPTGNAGQ
Download sequence
Identical sequences G3P1F5
69293.ENSGACP00000011428 ENSGACP00000011428 ENSGACP00000011428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]