SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011443 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011443
Domain Number 1 Region: 464-583
Classification Level Classification E-value
Superfamily PH domain-like 1.1e-21
Family Pleckstrin-homology domain (PH domain) 0.00000188
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011443
Domain Number - Region: 347-452
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000137
Family Synaptotagmin-like (S variant) 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011443   Gene: ENSGACG00000008655   Transcript: ENSGACT00000011466
Sequence length 1274
Comment pep:known_by_projection group:BROADS1:groupXIX:9666876:9737045:-1 gene:ENSGACG00000008655 transcript:ENSGACT00000011466 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLDPSSSEDTGGESDLEAAQEAPKKAAAGPAGKRGENNNSRPGAQRRRSGAPGAEPGAGA
PACGAALQIYVFVLRCIAYPFNAKQPTDMARRQQKVNKQQLQAVKERFLAFLSGETQIVA
DEAFCNAARSYYEGFLKSERVSRMVHGGGCSASDFREIFKKNIERRVRSLPEIDGLSKET
VLSSWIAKYDAIYRGEEDARRPSQRAHLSAASELILSKEQLYEMFQQILGIRKFEHQLLY
NACQLDNVDEQAAQIRRELDGRLQLAEKISRDGRHPKFVSADMEPLYVEELRSAVNLLMA
NLESLPVSKGGPDFKQKLKRSTMNNSFLDMGDEGDVLSKSDVVLSFTLEIVIVEVQGLKS
VAPNRVVYCTMEVEGGEKLQTDQAEASRPQWGTQGDFTTTHPLPSVKVKLFTESTGVLAL
EDKELGRVVLNPTTNGPKQADFHRMVVPKSSQDTELKIKLAVRMDKPPNMKHSGYLYASG
QRVWKRWKKRYFVLVQVSQYTFAMCSYREKKAEPQELMQLEGYTVDYSDPQPGLQGGRVF
FNAVKEGDLVMLACDDEQDRMLWVQAMYRATGQSYKPVPPPQNKTTNCRGGLQKPASPIS
LDPSQRQGVEGLISAAPCHFDHAALFSVLQKRTLQHRMNDSFSCLGWFSPGQVFVLDEYC
ARYGVRGCHRHLSYLRDLMEYSESNALVDPTLLHYSYAFCASHVHGNRPDGMGTVTAEEK
QDFEAIRGRIVSLLENQITHFRYCFPFGRPDGALKATLSLQERVLMKDITTPVPPEEIKN
LVRRCLENAAQINYSQLIEYAQVKADPQASTGKRLEDAMRLGELCMEVLQQNDEHHSEGR
EAFSWWPELMAEHAEAFLSLYRADMDAALQVQPVDSWDSFPLFQLLNNFLQTDPHLCNGT
FHKHLQALFVPLVVRYIDLMESSIAQSIHRGFEQETWQSVKSLTHNLASVPLPKVPSLPL
TLPQMPSFSAPAWMGPLCENTNGSATSEDLFWKLDALQMFVLDLHWPEAEFAKHLEQRLK
LMASDMMEACIKRTKSAFDSKMQKASKSTDFRVALSVCTMFNVLMDAKKQCSKLCVLDTG
QEQQYHSKIDVLIDEAFKDMISSLVMKLAAVLDGVLSKLSRYDEGTFFSSILSFTLIKIS
GKYIRITKPGMDLADTYITFIRQNQDILRDRINDELHVEEVFEQWYSSSMKVVCVWLADR
LDLQLHTYQLKTLIKIVKKTYRDFRLQGVLDATLNNKSYETVYTRLAGEEATAAVKSGDG
LQGISMRDSDEEDD
Download sequence
Identical sequences G3P1H0
69293.ENSGACP00000011443 ENSGACP00000011443 ENSGACP00000011443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]