SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011446 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011446
Domain Number 1 Region: 812-1096
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.29e-69
Family Protein kinases, catalytic subunit 0.00000601
Further Details:      
 
Domain Number 2 Region: 516-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.04e-43
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Domain Number 3 Region: 383-485,521-546
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-19
Family SH2 domain 0.0015
Further Details:      
 
Domain Number 4 Region: 267-370
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000283
Family Third domain of FERM 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011446   Gene: ENSGACG00000008647   Transcript: ENSGACT00000011469
Sequence length 1113
Comment pep:known_by_projection group:BROADS1:groupVIII:9818037:9827048:-1 gene:ENSGACG00000008647 transcript:ENSGACT00000011469 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLREEESAPLVIRDWGGSQRLRSTNGPNLQVHLYFLPSTKNETTIHISSGQISAENVCI
QACKKCGILPVYQSVFGLASTDLSFWYPPSHMFNTEEDVQVHFRVRFFFGNWFGQGPGTS
YRYSLTRDRISPVFDCSVIDYLFSQLRSDFIACEAGVCPPLSAQEECLGLAVLDLWRMAK
ERHQSVKELCMTVSYKSCLPMSHREDIQRRNRLDRYRIRNTLKRFLKKLGSCSIDECSLK
LKYLIELAGIVPSLGSETFQVNPSSSQSQSTFSLVKVTWERGIETSGSLHPDEELVRWHT
FSDFKEIIDIGIKRVCHEQVPQDSRVVTITRKDDRCLEANFQSLKEALSFVSLVDGYFRL
STDSNHYFCQNIAPPSVLEGIKNHCHGPITSEFAVSKLKKSGFKGGTFLLRQSPKNYDNF
FLTVCVQQTPLGLDYKDCLIIKNERYSLPGVQKSFSSLKELTGYYQQNKLLLADVPVKLL
RCCPPQHKELTNLIIIRNRSSVEAQGSPTPQGKKFSHIEFHMIKYKDLDLGESLGQGSFT
RNFKGYKTDIRDGEKYVTPVFLKELDVIHKHRWESFFEAASVMSQISHSHLLLVYGVSVH
GVQNIMVQEFVEYGALDLYLKRRRSLSMSWKLDVAKQLASALLFLEEKNIVHGNICAKNL
LLAREDDPSQGISPFIKLSDPGISVAMLGKEVTLDRIPWVAPELLDSPENLTLGCDKWSF
GATVWEIFNNGNTPLLGWELEKKEQFYKSFQQLPPSQWTELADLVSQCMDYQAVFRPSCR
CIIRQLNSLITSDYVILHATEPIAKSSVRRTSIPAQPEQTVFEERHLRFISSLGKGNFGS
VELCRYDPLGDNTGELVAVKKLQPNEKSTLEDFKKEVKILSIFECEYIVKYKGICYSTGR
LSMSLVMEYLPHGNLIGYLNTYQHINTRRMLLFASQICKGMEYLQSLRYVHRDLAARNIL
VASESLVKIADFGLTKVIPFDKDYYRVMQPGESPIFWYAPESINESRFSHKSDVWSFGVV
LHELFSYCNTNYNPKRLCMQEIGHNVHNPSVSMHLENILKSNWRLPAPSNCPPEVYGLMK
QCWAYNFEERPCFSSLGKQIETIMQEERDNLKG
Download sequence
Identical sequences G3P1H3
ENSGACP00000011446 ENSGACP00000011446 69293.ENSGACP00000011446

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]