SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011447 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011447
Domain Number 1 Region: 274-393
Classification Level Classification E-value
Superfamily PH domain-like 2.68e-22
Family Pleckstrin-homology domain (PH domain) 0.00000188
Further Details:      
 
Domain Number 2 Region: 157-262
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000899
Family Synaptotagmin-like (S variant) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011447   Gene: ENSGACG00000008655   Transcript: ENSGACT00000011470
Sequence length 521
Comment pep:known_by_projection group:BROADS1:groupXIX:9698826:9717838:-1 gene:ENSGACG00000008655 transcript:ENSGACT00000011470 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AIYRGEEDARRPSQRAHLSAASELILSKEQLYEMFQQILGIRKFEHQLLYNACQLDNVDE
QAAQIRRELDGRLQLAEKISRDGRHPKFVSADMEPLYVEELRSAVNLLMANLESLPVSKG
GPDFKQKLKRSTMNNSFLDMGDEGDVLSKSDVVLSFTLEIVIVEVQGLKSVAPNRVVYCT
MEVEGGEKLQTDQAEASRPQWGTQGDFTTTHPLPSVKVKLFTESTGVLALEDKELGRVVL
NPTTNGPKQADFHRMVVPKSSQDTELKIKLAVRMDKPPNMKHSGYLYASGQRVWKRWKKR
YFVLVQVSQYTFAMCSYREKKAEPQELMQLEGYTVDYSDPQPGLQGGRVFFNAVKEGDLV
MLACDDEQDRMLWVQAMYRATGQSYKPVPPPQNKTTNCRGGLQKPASPITNDSLDPSQRQ
GVEGLISAAPCHFDHAALFSVLQKRTLQHRMNDSFSCLGWFSPGQVFVLDEYCARYGVRG
CHRHLSYLRDLMEYSESNALVDPTLLHYSYAFCASHVHGNR
Download sequence
Identical sequences G3P1H4
ENSGACP00000011447

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]