SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011450 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011450
Domain Number 1 Region: 562-596
Classification Level Classification E-value
Superfamily WW domain 0.000000000278
Family WW domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011450   Gene: ENSGACG00000008671   Transcript: ENSGACT00000011473
Sequence length 736
Comment pep:known_by_projection group:BROADS1:groupXX:10047453:10053140:-1 gene:ENSGACG00000008671 transcript:ENSGACT00000011473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RWAQTKTLPHPAEMDGYSSENTSRAQTPLNTPDGSSTKQGPELDGDASKPAVYRRLKIIS
ENSLDSALSDASKDQECGEEQTPQPVTEKVELEGDKPTAEVLDSENQSIQTDVAALPPEE
PSENKEPQVETQEAEKPPPCTVIGTPSQDEEEGVSDVESERSQEPPLSALDIGGMAARLL
DSWKDLKEVYRIPKKSQVEKEATDRSRDRDAALTPRTASGSRERERERDKERTPQRSAER
RRRRSGSPPPSYERSSRRTEERFDTSNSSKTRGKERNKLSTEERRKLFEQEVAQREALKQ
QQQLQTMVYDPALAYVSSAGFITYPPGYPIQTFVDPTNPNAGKVLLPTPAVEPALSYEET
PPQRLVSDLPLSSPSSTSQATPVPALPQHIATTELAASNPPQYTQPAVATQDAGVAVLSA
PPQVAPQVQSQQSYTTLWDPATQQAVTVQTQPAQQYAAAPAPPQAQTAIYYQGQPCQTIY
SIPAAYPQANAPVIQAYTEPTASYLHGQPVYPGHQQGVVVQQGGTVTTIVTSQTVQQIHD
QEMIVPNNVIDLPPPSPPKPKTIVLPPNWKVARDPEGKIYYYHIATRQTQWDPPTWDSCS
DNTSVDHESEMDLGTPTYDENPSKFSTKTAEADTSSELAKKSKETFRKEMSQFIVQCLNP
FRKPDCKLGRISNTEDFKHLARKLTHGVMNKELKACNNPEDLECNENVKHKTKEYIKKYM
QRFGTVYRPKEDTEVY
Download sequence
Identical sequences G3P1H7
69293.ENSGACP00000011450 ENSGACP00000011450 ENSGACP00000011450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]