SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011471 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011471
Domain Number 1 Region: 280-521,555-620
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.4e-55
Family Diacylglycerol kinase-like 0.018
Further Details:      
 
Domain Number 2 Region: 5-114
Classification Level Classification E-value
Superfamily EF-hand 5.72e-22
Family Calmodulin-like 0.017
Further Details:      
 
Domain Number 3 Region: 96-164
Classification Level Classification E-value
Superfamily Cysteine-rich domain 4.78e-16
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0031
Further Details:      
 
Domain Number 4 Region: 166-232
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000000359
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011471   Gene: ENSGACG00000008651   Transcript: ENSGACT00000011494
Sequence length 642
Comment pep:known_by_projection group:BROADS1:groupXVI:17329585:17363842:-1 gene:ENSGACG00000008651 transcript:ENSGACT00000011494 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVFLKDIVCYLSLLERGTPEDKLEFMFRLYDTDGNGVLDSSELDRIINQMVHVAEYLEWD
STELRPILKEMMEEIDYDGDGTVTLEEWIRGGLTTIPLLVLLGMETNVQEDGQHVWRLKH
FNKPAYCNYCHTMLLGVRKQGLCCSLCKYTVHERCVSKDIAACISTYAKSRRHTNAMQHV
WMEGNSPTKCDRCHRSIKCYQGLTGLHCVWCQISLHNKCASNVKPECDGGALRDHTLLPS
YICPVVLVRPVGARRHRTGAGGRTAEAVFAPRLQVTPLPGTHPLLVLVNPKSGGRQGERV
LRKFRYLLNPRQVYSLEQGGPMVGLNFFHDVADFRVLACGGDGTVGWILDCIDKANFARH
PPVAILPLGTGNDLARCLRWGGGYEGGSLLKFLRDIEHSNEVVLDRWNIAIVPDDKEEKG
DPVPYSIVNNYFSIGVDASIARRFHLMREKHPEKFNSRMKNKLWYFEFGTTETISATCKK
LNECIEVECDGIIVDLSNTSLEGIAVLNIPSMHGGSHLWGESKKRRNYNRMSKKAPERAP
AGTVTDAKELKFCMQDFSDQLVEVVGLEGAIEMGQIYTGLKSAGRRLAQCANVTIRTSRR
LPMQIDGEPWMQPPCTIRITHMNQVPILLGPPQKTPFFFFKK
Download sequence
Identical sequences G3P1J8
ENSGACP00000011471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]