SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011559 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011559
Domain Number 1 Region: 406-613
Classification Level Classification E-value
Superfamily PUA domain-like 4.72e-78
Family SRA domain-like 0.00000000672
Further Details:      
 
Domain Number 2 Region: 1-75
Classification Level Classification E-value
Superfamily Ubiquitin-like 4.37e-17
Family Ubiquitin-related 0.0000454
Further Details:      
 
Domain Number 3 Region: 697-765
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000000734
Family RING finger domain, C3HC4 0.008
Further Details:      
 
Domain Number 4 Region: 321-373
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000082
Family PHD domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011559   Gene: ENSGACG00000008745   Transcript: ENSGACT00000011582
Sequence length 777
Comment pep:known_by_projection group:BROADS1:groupVIII:9867117:9873320:1 gene:ENSGACG00000008745 transcript:ENSGACT00000011582 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTMDGRETHRVDSLSKLTKVDELRLKISELFKVEPERQRLFYRGKQMEDGHTIFD
YNVGLNDIVQLLVRQKMSAVDVVKSKDKEAELSDSDSGCGSTQSESDKSSTHGEVEGQTA
STSSQTNTPELVDPGFGLYKINELVDARDLNMGAWFEAQIVNVTKTTKTPKEEAAEEVSA
EEILYHVKYEDYPENGVIQLLGKDVRPRARTVYQWHQLEPEMVIMVNYNPDDPKERGYWY
DAVIEKKRETRTVREIYAKIILGDAGDSINDCRIMFLTEIYKIEEPGSPGDAPAGSESPL
KRSNGPECKHCKDDPKKNCQWCNCHICGIKQDPDKQLLCDECDMAFHTYCLNPPLTTIPE
DEDWYCPGCRNDASEVVLAGEKLKESKKKSKMASASSSSQRDWGKGMACVGRTKQCTIVP
SNHYGPIPGVPVGSMWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDDGN
EFTYTGSGGRDLSGNKRTAEQSCDQTLTHMNRAVALNCNVPVNDKNGAESKSWKQGKPVR
VVRSCKGRKHSKYSPEEGNRYDGIYKVVKYWPAKGKSGFLVWRYLLRRDDDEPAPWTRDG
KERIKKLGLTIQYPAGYQKEKENKDEVEEEAATPSKAKRKRKSQGSDSSKTPPGRTPKKV
KLEVYKLTQEQKSLIKNDKQNKKVWDEAMESLSLGPKFLNKVEEIFHCICCQEVVYQPVT
TECQHNVCRECLQRSFRADVYTCPACRHDMGKNYPMTVNKSLQDILNQFFPGYSSGR
Download sequence
Identical sequences G3P1T6
ENSGACP00000011559 69293.ENSGACP00000011559 ENSGACP00000011559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]