SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011572 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011572
Domain Number 1 Region: 64-330
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-41
Family PhyH-like 0.08
Further Details:      
 
Domain Number 2 Region: 911-967
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 2.65e-20
Family Tudor domain 0.00051
Further Details:      
 
Domain Number 3 Region: 968-1023
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0000000107
Family Tudor domain 0.0011
Further Details:      
 
Domain Number 4 Region: 739-782
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000171
Family PHD domain 0.0092
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011572
Domain Number - Region: 825-885
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000664
Family PHD domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011572   Gene: ENSGACG00000008762   Transcript: ENSGACT00000011595
Sequence length 1053
Comment pep:known_by_projection group:BROADS1:groupVIII:9877605:9909505:1 gene:ENSGACG00000008762 transcript:ENSGACT00000011595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAPVSAKNASCKIMTFRPTVEEFKDFAKYIVYMETQGAHRAGLAKVIPPEGWKPRRSY
DTIDDMVIPAPIMQVVTGQSGLFTQYNIQKKSMTVNDYRKLANSKKYCTPRHKDFDDLER
KYWKNLTFVSPIYGADVSGSIYDEDIQEWNIGHLNTLLDMVEQECGIVIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGQSKSWYAVPPEHGKRLERLAKGFFPGSSQGCDAFLR
HKMTLISPSILKKYGIPFDRITQNEGEFMVTFPYGYHAGFNHGFNCAESTNFATLRWVDY
GKMATQCTCRKDMVKISMDVFVRCLQPDRYELWKQGKDSTVLDHLKATGLSCPELERWRE
HRVSHRANVLRRALQKVKQVRRLKLEEVKVLAQEGIELNAAEYQLQVEQREAQRRQAREE
RLAKEAIMTLEAMEREEQEAAEAAARVAEAPAAEGEDDKSSWTFLPQTLSRAIAILKGTV
SCENMMKLNPSIKPGWHRAKKSKDYLCKEAEVKPQNPSENIQKKRQKKSKKLSNIYNTMT
AFEEVFDQFATTSTKTVGQPAEENLLTPRQSDLPLDNKRDVIAAQVRLFSFKLKSQSRNA
FSKVKMPTEVKKSRRHPLSKPPMRSPLSILKQDPTSDKELSSPMPLDSDMKKQEHLWQNH
SPNFLAEKAFNAAVAALQPHCAVCLLFCPYTKPLQPHKDIFVANETKRGSLPRLTRPLVP
EMCFSVGAGNTEPPPTNYHIGEDGTSPLLCCSSCHMQVHASCYGVKPDSVCDSWMCSRCA
AGAWTVECCLCNLRGGALKTTTDNRWVHVICAIAVAEARFVNAIEREPVDVSAVPETRKN
LKCVFCHGKTANQNRGACIQCSHDNCATSFHVTCAQLAGVVMTPADWPYVVSVTCQKHKR
GSSKVRAFKSPNLSQRVIGRNSDGWYYHCTIIGMATQTYYEVNFDDGSYCDNLHPENILS
HDCLRTGPPEVGELIVVSTAEGQVVNASFVRQHTHKFYQVEFQDQSQLILKHSEIHQLEQ
DLPKRVRARLAIPVPLEEVSSADEAQAAKRRRL
Download sequence
Identical sequences G3P1U9
ENSGACP00000011572 ENSGACP00000011572 69293.ENSGACP00000011572

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]