SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011590 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011590
Domain Number 1 Region: 117-388
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.51e-58
Family Hypoxia-inducible factor HIF ihhibitor (FIH1) 0.056
Further Details:      
 
Domain Number 2 Region: 4-64
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.59e-18
Family PHD domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011590   Gene: ENSGACG00000008770   Transcript: ENSGACT00000011613
Sequence length 982
Comment pep:known_by_projection group:BROADS1:groupXII:10862325:10868928:1 gene:ENSGACG00000008770 transcript:ENSGACT00000011613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASVPLYCLCRLPYDVTRFMIECDICQDWFHGSCVGVEEDKATEIDLYHCPNCQVTHGPS
VMRKRRGANKQTDNGAAAGARDPSRPVKTGSPQFVRELRSRTFPGADDVLLKPSGAQLTV
EFLEEHSFSVPVMVLRRDGLGMTLPPASFSVSDVEHYIGSDKQIDVIDVSRQCDMKMRLG
DFVEYYNSPNREKVLNVISLEFSETRLSNLVETPKIVRKLSWVENLWPEESVFERPNVQK
YCLMGVKDSYTDFHIDFGGTSVWYHVLRGEKIFYLISPTAANLALFERWSSSSNQNEMFF
GDQVDMCYKCSLKQGNTLFIPTGWIHAVLTPVDCVAFGGNFLHSLNIDMQLRAYEIEKRL
STADLFSFPNFETVCWYVGKHLLDTFRGLRENRRHPATYLVHGAKALNNAFRTWTRKEAI
ADHEVEIPETINTQTLVKDLAKEIRLVEDIFQQNIGRSGPQFPGSPLPKAPLITAQNSGR
PPGKKKGPKPKEVMVGLGPPGAKKKGQKGLLKAEAGELDLIEIHTKHTLKKCQHGKSKNK
NKLDLPLDEFEGKLKKSKLKLVLTNGKLQGFSKKVGSNGARKAGKYKHLAVEGSSPSDLE
SEDELQIDETPPPARRKPAGHGLPRKLPRAKPCSDPNRIREPGEVDFDIEEDYTTDEEAL
AAHGVKGGAGGILDLLKASKQVAGLDSATLSEEAPASPSTRDAIQGMLSMANPPSSSSSS
SSSSPLSISGGLTEGLGVVKKKPVIQRPGKRPIKRPARHLSDEDSPDEQETLGTCFKDSD
YVYPSLESDEEDRANKAKMKRKKNWDDTPWSPKARVMPTLPKQDRPAREGARVASVETGL
AAAAAKLAQQEQKKPARRKYTKKQRPPAPVASPPPVQTEPAPPSPPPAPETAADLSPDRR
MDYYSASLMDHEYTAGPGPFGPGGPRGSGAMAPGVFLTSRRPSLSPQNSSSHSGKRPKKG
LATAKQRLGKILKIHRNGKLLL
Download sequence
Identical sequences G3P1W7
ENSGACP00000011590 69293.ENSGACP00000011590 ENSGACP00000011590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]