SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011629 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011629
Domain Number 1 Region: 3977-4333
Classification Level Classification E-value
Superfamily Hect, E3 ligase catalytic domain 2.62e-129
Family Hect, E3 ligase catalytic domain 0.0000000338
Further Details:      
 
Domain Number 2 Region: 1618-1684
Classification Level Classification E-value
Superfamily WWE domain 1.7e-17
Family WWE domain 0.002
Further Details:      
 
Domain Number 3 Region: 1306-1359
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000225
Family UBA domain 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011629
Domain Number - Region: 280-440,520-641
Classification Level Classification E-value
Superfamily ARM repeat 0.000184
Family Plakophilin 1 helical region 0.099
Further Details:      
 
Domain Number - Region: 101-179,276-468,816-831,1426-1567,2123-2202,2246-2262,2445-2485
Classification Level Classification E-value
Superfamily ARM repeat 0.00288
Family MIF4G domain-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011629   Gene: ENSGACG00000008789   Transcript: ENSGACT00000011653
Sequence length 4340
Comment pep:known_by_projection group:BROADS1:groupXII:10877468:10912720:1 gene:ENSGACG00000008789 transcript:ENSGACT00000011653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVDRSKLKKTPTEAPADCRILIEKLKACSDEQLLVELQHIKTWNIGKCELYHWVDLLDR
FDGILCDAGQTVENMSWLLVCDRPDNGQLKALLLAVLNFTALLIEYSFSRHLYSSIEHLT
TLLASCDMQVVLSVLNLLYVFSKRSNYITRLGSDKRTPLLARLQHLAESWGGKENGFGLA
ECCRDLLMTKYPPSATTLHFEFYAEPGPEVKVEKKTSTNTLHYIHIEQLDKISESPSEIM
ESLTVMYNIPKDKQTLLFTHIRLAHGFSDHKKRLQAVQARLHAISILVYSNALQESANSI
LYNGLIEELVDVLQITDKQLVDIKAASLRTLTSIVHLERTPKLSNIIDCTGTASYHGFLP
VLVRNCIQAMIDPLMEPYPHQFATALFSFLYHLASYDAGGEALVSCGMMEALLKVIKFLG
DEQDQITFVTRAVRVVDLITNLDMAAFQSHSGLSIFISRLEHEVELSRKECPFVIKPKIQ
RPSTAAESEDMDTDMESMQCIPQRAALLKSMLNFLKKAIQDPAFSDGIRHEVMDGSLPTS
LKHIISNAEYYGPSLFLLATEVVTVFVFQEPSLLSSLQDNGLTDVMLHALLIKDVPATRE
VLGSLPNVFSALCLNARGLHSFVQCQPFERLFKVLLSPDYLPAMRRRRSSDPLGDTASNL
GSAVDELMRHQPTLKTDATTAIIKLLEEICNLGRAPEYICQKPSIQKADGTVAVPPARSS
HAAEEASSEDEEEEEALHTFSQQQGEPESNRQVVGTEERIPIPLMDYILNVMKFVESILS
NNTTDDHCQEFVNQKGLLPLVSILGLPNLPIDFPTSAACQAVAGVCKSILTLSHEPKVLQ
EGLCQLDSILTSLEPLHRPIEVPGGSVLLRELANAGHVTDPTLSARATPLLHALTAAHAY
ILMFVHTCRVGQSEIRAISVNQWGSQLGLSVLNKLSQLYCSLVWESTVLLSLCTPNSLPP
GCEFGQADMQKLVPKEEKPSGSTAPATSSGSRRTESEAVTVDSTTGGLLEGMGLDGDTLA
PMETDEPTATDPKAKSKLTPAMATRIKQIKPLLSASSRLGRALAELFGLLVKLCVGSPVR
QRRSHHATSTGTTPTPAARATASALTKLLTKGLSWQPPPYTPTPRFRLTFFICSVGFTSP
MLFDERKYPYHLMLQKFFCSGGHDALFETFNWALSMGGKVPVSEGLEHTDLPDGTGEFLD
AWLMLVEKMVNPSTVLDSPHSLPAKTPGVTPTMPQFSALRFLIVTQKAAFSCIRSLWNRK
PLKVYGGRMAESMLAILCHILRGEPVIQERLAKEREGALRPDDEAHSANSTPRRDPQVNQ
AQLTQLMDMGFSREHAMESLLNTSTMEQATEYLLTHPPPLLGGAVRDLTMSEEDQMMRAI
AMSLGQEVSMEQRSDSPEEAARRREEDDRRARERAEEEEARCLERFMEAEPLDPKELHTF
TDSMLPGCFHLLDELPDTVYRLCDLLMTAIKRSGAEYRDLILGQVVDQVWQAADTLIKAA
EPLTTSDTKTVSEWTRQMATLPQASKLATRILLLTLLFEELKLLGARVVENSGILDLLIK
LLEVVQPCLQAAKEQKDIQTPKWITPVLLIIDFYEKMAVSSKRREQMNKYLQPNGNNWRW
FDDRSGRWCSYSASNNSTIDSAWRAGESSVRFTAGRRRYTVQFNTMVQVNEETGNRRPVM
LTVQRVPRMPKPAKAGGITDSERDEEDRSKAEETQTDLDSEAAVEMSVTKEDSSQPKEAS
SAPESDNSQSADIVVQGLTGDMTTVLIRACVSMISVPVDPDTLHATLRLCLRLTRNHHYA
MMFAELKSTRMILGLTQISGFNGFTPLVTLLFRHIIEDPATLRHTMEKVVRSAVTSGAGS
TTSGVVSGSLGSREINYILRVLGPAACRNPECFAETASNCVRIALPAPRGAGTASDDEFE
NLRIKGPNAVQLVKTTPLKLSPLPIIPDTIKEVIYDMLNALAAYHAPEERGTAERPEELP
GGPDLCQILQDVGDDVYQQYRLTRQGSDFDSQSAFHINAQVFSADGAVAESSQSGTPQGE
ASTPEEMREEKKEQEGEKSTSSEEGKAAKVKARKPLMPTSTILRLLAELVRSYVGIATLI
ASYCYTAGQSELIKEDCSVLAFVLDHLLPHTQNLEDKDTPALARLFLASLAAAGTGTDAQ
VALVNEVKAALSRALAMTEGPEKHARLQAVMCIISTIMESCPSTSSFYSTAAAKTQHNGM
NNIIRLFLKKGLVNDLARVPHSLDLSSPNMANTVNAALKPLETLSRIVNQPSSLFGAKGG
SSKNKPEHDTVGTARDSNSNTQDQGESGESEPVEGNHRVQGRDNDLMDGETEGDTVVIAG
QPEVLSTQAMQVENELVDLIDELLERDAGTVNSTIIVGRGGEDESQEDVLMDEAPSNISQ
ASTLQANREDSMNILEPEDEEHTQEEDSSGSNDDEDSDSCLLLFLQDDEEGDEDDDDEGS
EMELDEDFPDINAAPHIRFERFDRDDDLIIEFDNMFSNNADIPPSPGNIPSSHPLMVRHA
DHGSLTLGVAGTSSRLAQGMGRSQRTLRQLTANSGHTIHVHYPGNRQPNPPLILQRLLGP
SAAADILQLSSSLPLQSRGRARLLVGNEDVHIIARSDDELLDDFFHEQSSTGGQTGTLSS
IPTALTRWTDECKVLDAESMHDCVAVVKVPILQHLESLRDEELEERREKRRRQLAEEEES
KQSERRASGAEQAREQTLQDVAEAPPSGEVTPTTPAPHEQTLVSLETPISQQVHQPITDL
LLAESHASSLAALAGAGLPPLSSADRPNSEAEASQMEMSPAPTIASLSPDIVETSEPAIV
GVSQLEGSPMDTSSPASATLEESTSNSAQTTQLSQELSGSGESGLTDRQTDAKTGYSSTS
VSSPGETMPRSESAGSHSQAIQEEPLPSTSNDDEDPLAGISLPEGVDPSFLAALPEDIRR
EVLQNQLGIRPPSRPAAATALPSTTAPVLGGQGLTEVSPEFLAALPPAIQEEVLAQQRAE
QQRRELAQQPQQGDTPLDPVTFIQTLPSELRRSVLEDMEDSVLAVMPPDIAAEAAALRRE
QEARQRQLMHERLFGHSSSSALSAILRSPAFTSRLGSNRGVQYTRLAVQRGGTFQMGGGT
NHRPSSSSVDSLLRLRGRLLLDHEALSCLLVLLFVDEPKLNTSRLHRVLRNLCYHSQTRG
WVIRSLLSILQRSSESEVCVETTRLEDSRGKRSTQSSSSSSSSSSSLELLNRVESRSSSQ
LSWLSVSMDAALGCRTNIFQIQRASGRKHADRHPAGGSTGVHIHPQAAPVVCRHVLDTLI
QLFFLCRFSPATFTQQRCKDLLSSSSDLDSRLCSIASLGGGSLGISTDFWDLLVKLDNMN
VSRKGKASMKTVPLGGSAEAEGAQLSLETSPLGQLMNMLSHPVIRRSSLLTEKLRLLSLI
SIALPDNKATEVPAGHPTPQAAIPSTASSSGVTAHITTQGTVSAGSIPPTLTVLGTSVGA
AIQGSSSGTSLAASQTSSTMISIPTSTGITSAAFAKTGKPRGTAISTECDNKMASSGLTE
KQLQLSVEVLTSHSCSEEGLEDAANILLQLSRGDGATRDTVLRLLLSGARHLGYTLCKQI
GTLLAELREYNLEQQRRAQADSNSPDGPPEDSSISGKPKGKISSRFDGSESVVIVAAQKR
TLGGRELQLPCMSSLTSKTSTQKFFLRVLQVIIQLREDTRRANKKAKQTGRLGSSSLGSA
SSIQAAVRQLEAEADAIIQMVREGQRARRLQQAPPSEVQSMSEAQAAQRDDSPMDVDQPS
PLEQDPAPLVITDNEDGNGPPESEERLPDLPLLSEQLLLDELWDMLGECLKELEESHDQH
AVLVLQPAVEAFFLVHATERESKPPVRDTRESQLSHIKDEPPPLSPAPLTPATPSSLDPF
FSREPSSMHISSNLPPDTQKFLRFAETHRTVLNQILRQSTTHLADGPFAVLVDYIRILDF
DVKRKYFRQELERLDEGLRKEDMAVHVRRDHVFEDSYRELHRKSPEDMKNRLYIVFEGEE
GQDAGGLLREWYMIISREMFNPMYALFRTSPGDRVTYTINPSSHCNPNHLSYFKFVGRVV
AKAVYDNRLLECYFTRSFYKHILGKSVRYTDMESEDYPFFQGLVYLLENDVSTLGYELTF
STEVQEFGVCEVRDLKPNGANILVTEENKKEYVHLVCQMKMTGAIRKQLAAFLEGFYEII
PKRLISIFTEQELELLISGLPTIDIDDLKANTEYHKYQSSSIQIQWFWRALRSFDQADRA
KFLQFVTGTSKVPLQGFAALEGMNGIQKFQIHRDDRSTDRLPSAHTCFNQLDLPAYESYE
KLRHMLLLAIQECSEGFGLA
Download sequence
Identical sequences G3P206
ENSGACP00000011629 69293.ENSGACP00000011629 ENSGACP00000011629

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]