SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011630 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011630
Domain Number 1 Region: 1841-2122
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-70
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0012
Further Details:      
 
Domain Number 2 Region: 692-858
Classification Level Classification E-value
Superfamily GroEL apical domain-like 2.33e-36
Family Group II chaperonin (CCT, TRIC), apical domain 0.00067
Further Details:      
 
Domain Number 3 Region: 366-493
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.8e-29
Family DEP domain 0.0032
Further Details:      
 
Domain Number 4 Region: 163-235
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 5.28e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011630
Domain Number - Region: 647-698,851-871
Classification Level Classification E-value
Superfamily GroEL-intermediate domain like 0.000855
Family Group II chaperonin (CCT, TRIC), intermediate domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011630   Gene: ENSGACG00000008803   Transcript: ENSGACT00000011654
Sequence length 2136
Comment pep:known_by_projection group:BROADS1:groupXVI:17457209:17475022:1 gene:ENSGACG00000008803 transcript:ENSGACT00000011654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAADDKSSSSSSADWSVEPPVSSPASPSHLTHFKPLTPEQDDPPLRSAYSSFVNLFRFNN
KEDGRSPSTVSEKPDAPSPSPQSERRSWSTSPTQSLYSSRGHRKQQPDLLRRTSTSEALY
GSRKSDTPLSNHDPRTAVQLRTALKRLKEIMEGRSQDSDLKQYWMPDSQCKECYDCNEKF
TTFRRRHHCRLCGQIFCSRCCNQEIPGKFMGYTGDLRACTYCRKIALSYAHSTDSCSIGE
DLSALSDSTCSVCVLEPSEPRTPVGGRKSSRNIFLEEDLTWQSMIHQEQQNSGLTSRLTA
RQEDVGKSPARKRSASVTNLSLDRASMAPSYDSAVSPPTSRGMSGTKSGTKLDHSEEERK
ILLDSSQLKDLWKKICHNSTGMEFQDHRYWLRTYPNCIVGKELVNWLLRNGTISTRAQAI
AIGQALVDGRWLDCVTHHDQLFRDEYALYRPLQSTEFSETPSPDSDSVNSVEGHSEPSWF
KDIKFDDSDTEQLADESEYAMPNSASPSKRTSVSSSQSVVDSDSAASINLNMEQNNVNFH
IKKQSKYPHVPSAAEQKVKAEFHLSEDGGQNIIISDAFIKESLFNRRVEEKAKEMLFTPL
GWHHSSLDQLREENGEKKAMERLLSANHSHMMALLQQLLYSESLSLSWRDIIVPVVRQVV
QTVRPDVRNCDDDMDIRQLVHIKKISGGRKFDSKVVNGFVCTKNIAHKKMNSHIKNPQIL
LLKCSIEYLYREESKFSCIDPIVLQEREFLKNYVQRIVDVRPTLVLVERTVSRIAQDMLL
EHGITLVINVKAQVLERVSRMTQGDLVMSMDQLLTKPRLGTCLKFFMQPFTLANDEAKTL
MFFEGCPPHLGCSIKLRGASDYELARVKEIIMLMVCVAYHSQLEISFLMDEFAMPPSLAQ
STSFPCLLEGTADGETSEESLEKTVVPEDSAQGGGTEEEGLPLESSPKTGDVDSFKEKHF
ADSSSPVRHEEAGNVEKMTSTPFSSPMTMPLCVPPPFLLEEDQEMDSDTLIMAPGGEAEE
EEEGSPGAKGDSHDRDEGDGAPATRSFRDPLQDDTGMFVAEQVDSSDDRLKSISAGFKQE
LKEIILCISPFITFREPFLLTPAGMHCPSRDYFPEQVYLSPLLNKDYKELDGRRKRQLLK
DSAPSALVSAQTNGALQPKPINVLPSHSLTSTRIVEQLSGSQDLAKMLADYRAQGGRIRQ
RDATDPFCAATPVSVQSKAPDGPPRPPARADSEEERPSRQTDVSLAPKLDCLNPVNHQRL
CVLFSSSSAQSSNAPNPCVSPWIVTMDFYGKNDLSLGVFLERYCFRPSYHCPSMFCETPM
VHHIRRFVHGSGCVQIVLKELDSPVPGYQHTILNYSWCRVCKQVTPVVPLSNDSWSMSFA
KYLELRFYGHQYSRRANAEPCGHSIHKDYHQYFSYNQMVASFSYTSVRLLEICLPRPKIF
IRNLGPSKTNLQQDLKDFTHKVTQVYLAIDDRLTSLKTDTFSKTREEKMEDLFAQKDMEE
AELRSWIDKLQVRLQACALDSPQQVQAVLESLVMKKQGLCEMLQSWNGRLQELFQQEKGR
KRLSVPPSPGRHRQTAADDSKCALDSSPRNPSPVVQNGDKVVCFVCCSPTEDRHLCILPS
PGEPAVEAFTPVPSFTEQDSLSIPEDVFDGHLLGSTDSQVKEKSTMKAILANFLPGNSYN
PIPFPFDPDKHYLMSEHERVPIAVCEREPSSIIAFALSCKEYKTSLDDLSKTSNAGGDET
PQAARYQRENRYRRKKVRSCFKETLRGKRNKWLRSLYLKRLPTGQLTCFLRSVLLLSAGE
SRTKSSPARPSESASSQQSRTSMETDPLKDAELGDKQKKQTLNPHVELQFSDANARFYCR
IYYAEEFHKMREEIMESTEEDFVRSLSHCVNWQARGGKSSGCICSSVPDDRFILKQMPRL
EVQSFLDFAPHYFTYITGAVQQKRPTALAKILGVYRIGYKNSQNNTEKKLDLLVMENLFY
GRKMAQVFDLKGSLRNRNVKTDSGKESCEVVLLDENLLKLIHDNPLYIRSHCKAILRAAI
HSDAYFLSSHLIIDYSLLVGRDDATDQLVVGIIDYIRTFTWDKRLEMVVKSTGILGGQGK
MPTVVSPELYRSRFCEAMDKYFLMVPDHWTGLGVNC
Download sequence
Identical sequences G3P207
69293.ENSGACP00000011630 ENSGACP00000011630 ENSGACP00000011630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]