SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011699 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011699
Domain Number 1 Region: 555-660
Classification Level Classification E-value
Superfamily Bromodomain 2.75e-32
Family Bromodomain 0.00033
Further Details:      
 
Domain Number 2 Region: 200-274
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.83e-18
Family PHD domain 0.01
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011699
Domain Number - Region: 315-352
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000126
Family PHD domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011699   Gene: ENSGACG00000008866   Transcript: ENSGACT00000011723
Sequence length 816
Comment pep:known_by_projection group:BROADS1:groupXIX:9958513:9962144:1 gene:ENSGACG00000008866 transcript:ENSGACT00000011723 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKKKSRHHRPAVLKRDSSPIKPSANRETLTYAQAQRIVELEVDGRMHRLSIYDKMDVIGD
DDPTAQEIMECNSNKENNEKPQQVLVRSVRLKNSQQKKNAALTAAHTGTGGLLEPKVRTV
EYNLPVVPKRPVAYYKYTERTSEELDEEVEYDMDEEDYAWLEIVNEKRRSEGVSQVSFNL
FEFLMDRFEKESHAATRGQSDLRSLVDEDAVCCVCMDGDGADSNVILFCDSCNIAVHQEC
YGVPYVPEGQWLCRHCLQCPARPADCVFCPNRGGALKKTDDDRWGHVACALWVPEVGFSD
TVFIEPIDGLRNIPPARWKLTCYLCKEKGAGACIQCDKINCYAAFHVSCAQRAGLYMKME
PVREVTLSGGASFSVKKTAYCCGHTPEGCDRRPLGIYEEPHAKNGACLKRADKRGKSRAK
GWARKKSKRGDPEPEAEAPASPGPSITISSFDTILNQVAVQRKRVFVERVLSYWVQKRQS
RNNVPLIRRLQAHPQPPKVKQTDRAETNQALKEQLKEWHRLRHDLERARLLLELIRKREK
LKREEMKLQQSALEVQLTPFNILLRAVLSQLQEKDQYSIFAHPVSAKEVPDYLDHIQDPM
DFSTMRKRIDGHAYRSLEEFEADFDLVIFNCMKYNAKDTFFYRAAQRMQDHGGAILRRAR
REAERIGFDFPSGLHLPEAPKPGAAPAFCWEDVDRLLTPAYRQLTPLEEQLRELLEKLDL
STAMKHSPSRSKRLKLLKKTITEVRSEMSLRQPPRKPPPEPSGTPPEEAAPKSPAEPRMV
IPRLETLLLPKKRRHSSSGDGEEEDEESPIKRLGTG
Download sequence
Identical sequences G3P276
ENSGACP00000011699 ENSGACP00000011699 69293.ENSGACP00000011699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]