SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011719 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011719
Domain Number 1 Region: 343-394
Classification Level Classification E-value
Superfamily UBA-like 0.00000000164
Family UBA domain 0.00086
Further Details:      
 
Domain Number 2 Region: 408-461
Classification Level Classification E-value
Superfamily UBA-like 0.00000217
Family UBA domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011719   Gene: ENSGACG00000008874   Transcript: ENSGACT00000011743
Sequence length 465
Comment pep:known_by_projection group:BROADS1:groupXVII:8463359:8467355:-1 gene:ENSGACG00000008874 transcript:ENSGACT00000011743 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARKSGSDAYNNGPISYLDEVPFKINDKFHCPAKVGLPVGFCLPDCNSLLLDSQYDFSL
ERLSVRWGVQLAEAREAEARAEEAAAKQEAESRECSAQAQDMDAGGGKRPRSAADDQDLL
PPALNPVLAGLSHNAILTPLPAPSLGPRKIQPSTPQLHSLNLADFEREEDPFDKLELKTL
DDREELRNILHPPSVSPPEVPPTGSGSRGNSPSPPRINTSQVSKSGFSHKPNGLISLLDM
DRVGHPGRTGFDTDDRPCNIRSLTFPKLSDSGDPEPVRYSPLPAPRQQLTNGSPPATPKT
QVIIGPEPTSHSKGGAPKPNTDVEIMNLIDIYANPGSGSAGLPCGGALLSMTPSERQCAE
TLVGMGYSYEGVLRAMQRQGQNVEQVLDYLFVHGRLCDRGFDAIAVEECLEMYQCSEEKA
LQFLELMSRFGEMGFQRDAIKEVLLVHNNDQDKALEDLMARAAAS
Download sequence
Identical sequences G3P296
ENSGACP00000011719 ENSGACP00000011719 69293.ENSGACP00000011719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]