SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011750 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000011750
Domain Number - Region: 152-187
Classification Level Classification E-value
Superfamily UBA-like 0.0242
Family UBA domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011750   Gene: ENSGACG00000008888   Transcript: ENSGACT00000011774
Sequence length 189
Comment pep:known_by_projection group:BROADS1:groupXX:10285002:10287485:-1 gene:ENSGACG00000008888 transcript:ENSGACT00000011774 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASCNESESEGSVPELEEPERRPSEPQSTSFSDDGLNRPKQSRSEKKARKAMSKLGLKPV
HGVTRITIRKSKSILFVISRPDVFKSPASDIYIVFGEAKIEDLSQQAHKAAAEKFKVPVT
SSPLAPPVPPSLTIKEESEEEEEEVDVGGLEQRDIELVMAQANVSRAKAVRALKNNKNDI
VNAIMELTM
Download sequence
Identical sequences G3P2C7
ENSGACP00000011750

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]