SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011751 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011751
Domain Number 1 Region: 269-335
Classification Level Classification E-value
Superfamily SH3-domain 6.3e-21
Family SH3-domain 0.001
Further Details:      
 
Domain Number 2 Region: 87-147
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000147
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011751   Gene: ENSGACG00000008897   Transcript: ENSGACT00000011775
Sequence length 393
Comment pep:known_by_projection group:BROADS1:groupXI:6085209:6095518:-1 gene:ENSGACG00000008897 transcript:ENSGACT00000011775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLQRLKRSLSFKTIMRSKSVENFFQRSYSDARLPPDFITDPPPPSPPLAPGSPLAGDRSP
SVSPSLSPNPSISSHSPSLSLSPSLPAKPQRPQITHCFQDHVFRKPTNCQHCKNMIVGNS
KQALRCKTCKMAAHLWCTSELSLQLCQGKEDTSGAFKRNFSSPMLVNDQLSVVKEVQPSQ
AEAVRMRVDPVYAALRYGTSLAQMSRSSFGSLSESPTRSLNEQGDVKHKGEGGVRQSLAP
PPSDVSVPDVEVEKEEDESCSGAPTPAEVPKRIEVHSIHTYVALYKFLPQEQNDLELQPG
DRVQVTDDSNEEWWKGKSGDKVGFFPANFVQRVRPGERVWRVVQGYPGSRERGHMAVRES
QICVGKREDGEVFLRLSSGKKRGLVPAESIEEI
Download sequence
Identical sequences G3P2C8
ENSGACP00000011751 ENSGACP00000011751 69293.ENSGACP00000011751

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]