SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011757 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSGACP00000011757
Domain Number - Region: 180-215
Classification Level Classification E-value
Superfamily UBA-like 0.0332
Family UBA domain 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011757   Gene: ENSGACG00000008888   Transcript: ENSGACT00000011781
Sequence length 217
Comment pep:known_by_projection group:BROADS1:groupXX:10285003:10288820:-1 gene:ENSGACG00000008888 transcript:ENSGACT00000011781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLEDSNLLEVTQGKMMRTKKESGESNESESEGSVPELEEPERRPSEPQIFFFFQSTSFS
DDGLNRPKQSRSEKKARKAMSKLGLKPVHGVTRITIRKSKSILFVISRPDVFKSPASDIY
IVFGEAKIEDLSQQAHKAAAEKFKVPVTSSPLAPPVPPSLTIKEESEEEEEEVDVGGLEQ
RDIELVMAQANVSRAKAVRALKNNKNDIVNAIMELTM
Download sequence
Identical sequences G3P2D4
69293.ENSGACP00000011757 ENSGACP00000011757 ENSGACP00000011757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]