SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011821 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011821
Domain Number 1 Region: 89-419
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.05e-88
Family Protein kinases, catalytic subunit 0.00000000074
Further Details:      
 
Domain Number 2 Region: 346-366,441-559
Classification Level Classification E-value
Superfamily PH domain-like 6.92e-45
Family Pleckstrin-homology domain (PH domain) 0.000000816
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011821   Gene: ENSGACG00000008933   Transcript: ENSGACT00000011845
Sequence length 565
Comment pep:known_by_projection group:BROADS1:groupV:10856732:10862000:-1 gene:ENSGACG00000008933 transcript:ENSGACT00000011845 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAKSQLYDVVPIQPSVVICSCSHPSMVRNHADSCSPLAIPGASSSHCPGIQGSPSEPR
AVGASASSQGSDIRTQPAMQTPQPRKKKPEDFRFGRILGEGSFSTVVLAREQGTGKEYAI
KILEKRHIVKANKAQYVKRERDLMSNLEHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKY
IRKIGSFDETCTRFYSAEIVCALEYLHNKGIIHRDLKPENILLSEDMHIQITDFGTAKQL
SSDSKQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCITYQLVAGLPPFRAGNEYLI
FQKIIKLEYEFPEKFFPKAKDLVKQLLSLDPSKRIGCEEMGGYDPLRQHPFFDTISWSDL
HLQTPPKLTPYLPAMSEDDEDCYGNYDDLLSQFSNMQVAQSSSTHSLSPHESTPPQRSSS
NIEQYIHDLDNNSFELDLQFTVEEKQLLLDKQTTGNPWHQFVENNLILKMGPVDKRKGLF
ARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSLELRPEAKNFKTFFVHTPNRTYYLMDPSG
NADRWCKKIQEVWRKIYQRPQNPGL
Download sequence
Identical sequences G3P2J8
ENSGACP00000011821 69293.ENSGACP00000011821 ENSGACP00000011821

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]