SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011824 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011824
Domain Number 1 Region: 219-239,314-430
Classification Level Classification E-value
Superfamily PH domain-like 1.15e-44
Family Pleckstrin-homology domain (PH domain) 0.000000873
Further Details:      
 
Domain Number 2 Region: 121-293
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.49e-28
Family Protein kinases, catalytic subunit 0.00000158
Further Details:      
 
Domain Number 3 Region: 76-121
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.0000108
Family Protein kinases, catalytic subunit 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011824   Gene: ENSGACG00000008933   Transcript: ENSGACT00000011848
Sequence length 431
Comment pep:known_by_projection group:BROADS1:groupV:10856756:10862000:-1 gene:ENSGACG00000008933 transcript:ENSGACT00000011848 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARAKSQLYDVVPIQPSVVICSCSHPSMVRNHADSCSPLAIPGASSSHCPGIQGSPSEPR
AVGASASSQGSDIRTQPAMQTPQPRKKKPEDFRFGRILGEGSFSTVVLAREQGTGKEYAT
RANSFVGTAQYVSPELLTEKSACKSSDLWALGCITYQLVAGLPPFRAGNEYLIFQKIIKL
EYEFPEKFFPKAKDLVKQLLSLDPSKRIGCEEMGGYDPLRQHPFFDTISWSDLHLQTPPK
LTPYLPAMSEDDEDCYGNYDDLLSQFSNMQVAQSSSTHSLSPHESTPPQRSSSNIEQYIH
DLDNNSFELDLQFTVEEKQLLLDKQTTGNPWHQFVENNLILKMGPVDKRKGLFARRRQLL
LTEGPHLYYVDPVNKVLKGEIPWSLELRPEAKNFKTFFVHTPNRTYYLMDPSGNADRWCK
KIQEVWRKIYQ
Download sequence
Identical sequences G3P2K1
ENSGACP00000011824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]