SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011835 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011835
Domain Number 1 Region: 32-270,303-328
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.19e-70
Family BAR domain 0.0016
Further Details:      
 
Domain Number 2 Region: 542-693
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.76e-69
Family Ankyrin repeat 0.000000225
Further Details:      
 
Domain Number 3 Region: 420-538
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 7.32e-39
Family Pyk2-associated protein beta ARF-GAP domain 0.00000237
Further Details:      
 
Domain Number 4 Region: 301-408
Classification Level Classification E-value
Superfamily PH domain-like 4.37e-21
Family Pleckstrin-homology domain (PH domain) 0.0058
Further Details:      
 
Domain Number 5 Region: 943-1001
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000683
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011835   Gene: ENSGACG00000008955   Transcript: ENSGACT00000011859
Sequence length 1003
Comment pep:known_by_projection group:BROADS1:groupXV:6146115:6183986:-1 gene:ENSGACG00000008955 transcript:ENSGACT00000011859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDQITVTEFVVETNEDYKSPTASNFTTRMSHCRNTVTALEEALDVDRSVLHKMKKSVKA
IYTSGLAHVENEEQYTQALEKFGENCVYRDDPDLGSAFLKFSVFTKELTALFKNLFQNMN
NIITFPLDSLLKGDLKGVKGDLKKPFDKAWKDYETKVTKIEKEKKEHARQHGMIRTEISG
AEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGVDLLQNLIKYFHAQCNFFQDGLKAVDN
LKPSIEKLATDLHTIKQVQDEERKQLTQLRDVLKTALQVEQKEDSQVRPSTTYSLHQPRG
NKEHGTERSGYLYKKSDGLRKVWQKRKCTAKNGYLTISHGTANRPPAKLNLLTCQVKHNP
EEKRSFDLISHDRTYHFQAEDDQDCQIWISVLQNSKEEALNQAFKGDQHVGENNIVQELT
KAILAEVKRMTGNDVCCDCGAPNPTWLSTNLGILTCIECSGIHRELGVHYFRIQSLTLDV
LSTSKLLLAKNVGNAGFNEIMEAGLSAENVVKPNPGSDMQARKDFITAKYTEKRFARKKC
PDATSRLHTLCDAVKARDIFSLIQVYAEGVDLMEPIPLANGHEQGETALHLAVRLVDRTS
LHIVDFLTQNSLNLDKQTAKGSSALHYCCLTDNSECLKLLLRGKASIEIANEAGETPLDI
ARRLKHIQCEELLTQALAGKFNAHVHVEYEWCLQHEDLDESDEDLDEKPSPHRRDERPVS
CYTPSSNSHLQASQGSAGRDAIGHAKDKQRAYMPNLVNNETYGTVLNNNNSPQPLSLCSA
PPLPPRNQAVQFSGLGGSGQPSLSSSWKPGALDLVGRQRSSSDPPNMHPPVPPLRLTSTG
GVSLCVPGLGPPVAKMESMSMQSKSGQGPLGSRAGPPKSPAGNDKSFTRPLNRTASIERP
GEQSVCRRLHSHSKEVPGCPQNSIGQSVPSGHTQKKTYPKQRPKRVKAIYNCQADNPDEL
TFSDGEVIVVDGEEDQEWWLGHIEGDPMRRGAFPVTFVHFIAD
Download sequence
Identical sequences G3P2L2
ENSGACP00000011835 ENSGACP00000011835 69293.ENSGACP00000011835

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]