SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011843 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011843
Domain Number 1 Region: 130-234
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.01e-24
Family Ubiquitin-related 0.0004
Further Details:      
 
Domain Number 2 Region: 287-391
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.73e-24
Family Ubiquitin-related 0.0004
Further Details:      
 
Domain Number 3 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.43e-18
Family Ubiquitin-related 0.00044
Further Details:      
 
Domain Number 4 Region: 78-155
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000164
Family Ubiquitin-related 0.0069
Further Details:      
 
Domain Number 5 Region: 235-312
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000164
Family Ubiquitin-related 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011843   Gene: ENSGACG00000008971   Transcript: ENSGACT00000011867
Sequence length 391
Comment pep:known_by_projection group:BROADS1:groupXIII:8978569:8989361:-1 gene:ENSGACG00000008971 transcript:ENSGACT00000011867 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQVFLKNEKGKLTTYDIGPSETVGYFKSRVKAREGVPKNQQRLIHQGREMSQDQSKLSDY
GVQATSTIDLSFRLRGWMDLTIVMLNGTSHNMRVDHQDTVGSLKRQIQQKLGVAYETQKL
VFTNGTSTHLNDDSKPISHYGLGPGARVSLLVTQPETIQVFLKNEKGKLSTYDIGPSETV
GYFKSRVKAREGVPENQQRLIHQGREMSQDQSKLSDYGVQATSTIDLCFRLRGGMDLTIV
MLNGTSHNMRVDHQDTVGSLKRQIQQKLGVAYETQKLVFTNGTSTHLNDDSKPISHYGLG
PGARVSLLVTQPETIQVFLKNEKGKLSTYDIGPSETVGYFKSRVKAREGVPENQQRLIHQ
GREMSQDQSKLSDYGVQATSTIDLCFRLRGG
Download sequence
Identical sequences G3P2M0
ENSGACP00000011843 69293.ENSGACP00000011843 ENSGACP00000011843

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]