SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011920 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011920
Domain Number 1 Region: 329-637
Classification Level Classification E-value
Superfamily PLC-like phosphodiesterases 7.33e-79
Family Mammalian PLC 0.00000676
Further Details:      
 
Domain Number 2 Region: 657-782
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.38e-29
Family PLC-like (P variant) 0.00053
Further Details:      
 
Domain Number 3 Region: 170-328
Classification Level Classification E-value
Superfamily EF-hand 6.01e-29
Family EF-hand modules in multidomain proteins 0.028
Further Details:      
 
Domain Number 4 Region: 41-155
Classification Level Classification E-value
Superfamily PH domain-like 4.12e-21
Family Pleckstrin-homology domain (PH domain) 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011920   Gene: ENSGACG00000009026   Transcript: ENSGACT00000011944
Sequence length 1031
Comment pep:known_by_projection group:BROADS1:groupXVI:17573546:17584616:1 gene:ENSGACG00000009026 transcript:ENSGACT00000011944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KASRRDAKSRKDPSVQKVGGGRKKTVSFSSMPSEKKVSSAADCLAFMQGGCELKKIRPNS
RVYCRFYTLDPDLSCLRWEPSKKDSERARLDVSRVREVRTGKSTETFLHNGPLTEHLAEE
AAFSVIHGEDYQSLDLVALSADVANIWVTGLRYLLGAGGLAVDGSPGGKMRSEWLAAEFA
QVDEDGYGIVSEDVAVGTICKLCPGIKEAKVRLRFKEIQRSKEKLTSHVTREEFHEAFCE
LCTRPDVYFLLVQLSKDRECLDPQDLRLFLETEQGLSLATAEGCWEILRRCEPSAQGKEK
GLLGLDGFARYLQSPECQLLDPEHLGVCQDMNMPLSHYYISTSYRSYLLEDQVHGRADLG
GLIRALRSGCRCVELGVTDGPEGEPLLGVDHGPDIPVTLRSALEVVSKYAFLTSQYPLLV
YLCQRCSPGQQRTMAQHLKKVLGSRLYRPEPPLADPAGRNRLLSSLKPMKVLVLIGEKRT
SPDLNMKHSTIAVHLREQDLGVVISVPPPSQPRKLRLHKELSDLVAIARTGSRGFYAQSS
EAPSWTLCSLGEGEAGRLTTESPEDLVMFTKRTLTRVRPSSVRLDSSNPNPQGYWKGGVQ
LVALNQQTPGAMLDLHRGRFSQNGGCGYVLRPAVMRDEVSYFSAHTQGCVPGVPAQTLRI
KVISAHNLPKPQGSGAKGEVIDPYVVLELHGVPADCAEQRTRTAAQNQDDPLFDETFEFQ
VNMPELALLRFVVLDDDYIGDDFIGQYSVAFECLQPGYRNVPLLGMAGDPLPHTSLFVHV
AVTNRAEGGKAQRRGLSARRVGRRGREYVALRHTGIKAVDESFKPAGAPLREATDLREDA
QSATASFKEQCGLPSVAKLKQCIQSLTTRLQGPEGAMGAAMVLREGYPCLEPLVGLAEPT
RKLLAAYDAMIAAQKQLIENADGVQERIAHVQREGMDFHEELSRLGEKEGLKGRKQSKAV
ESFTWNITVLKGQNDLLRGAQMDSLDALRQLALACEACGLASDPSASAELHRSSSQPPSG
RRSSTHGNGRV
Download sequence
Identical sequences G3P2U7
ENSGACP00000011920 69293.ENSGACP00000011920 ENSGACP00000011920

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]