SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011960 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011960
Domain Number 1 Region: 35-162
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.05e-58
Family N-terminal domain of cbl (N-cbl) 0.000000281
Further Details:      
 
Domain Number 2 Region: 249-335
Classification Level Classification E-value
Superfamily SH2 domain 4.2e-48
Family SH2 domain 0.00000241
Further Details:      
 
Domain Number 3 Region: 341-421
Classification Level Classification E-value
Superfamily RING/U-box 3.09e-41
Family RING finger domain, C3HC4 0.0000102
Further Details:      
 
Domain Number 4 Region: 164-248
Classification Level Classification E-value
Superfamily EF-hand 2.92e-37
Family EF-hand modules in multidomain proteins 0.00000793
Further Details:      
 
Weak hits

Sequence:  ENSGACP00000011960
Domain Number - Region: 873-908
Classification Level Classification E-value
Superfamily UBA-like 0.000187
Family UBA domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011960   Gene: ENSGACG00000009060   Transcript: ENSGACT00000011984
Sequence length 921
Comment pep:known_by_projection group:BROADS1:groupI:8081930:8106122:-1 gene:ENSGACG00000009060 transcript:ENSGACT00000011984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGNLKKSGGLIGRMMKDAFQPHHHHLHSHHQPGVVDKKTVEKCWKLMDKVVRLCQNPKL
ALKNSPPYILDLLPDTYQHLRTILSRYEGKMEMLGDNEYFRVFMENLTKKTKQTISLFKE
GKERMYEENSQPRRNLTKLSLIFSHMLAELKAIFPNGLFQGDNFRITKADAAEFWRRAFG
DKTIVPWKVFRQSLHEFHPISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLFQPWSSLL
RNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNIL
QTIPHNKPLFQALIDGFREGFYLFPDGRTQNPDLTGLCEPSPQDHIKVTQEQYELYCEMG
STFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESEGQGTGCPFCRCEIKGTEPIVVDP
FDPKDNSGGSCRGMFGAEGAPSPSYDDDDDDRLEDPHLMMTKLACSKVERPPSPMSMAPQ
SSLPPVPPRLDLLPHRPPNPPAACSPVANSKLASHHKDKPLPLLPALRDLPPPPPPERPH
TVGAAPDGRVQRRPLPCTPGEPLRDKLPPTPPNRPPAEWNSRPVPKAPTSSNQVSGLGVD
LRAGVRELSNRHSLPLALPSALDPRSDSSKNNSSLSLDHQLNSTAVAGHDYDKAKVKPSS
SANAIYSIAIRTSSTQRLVTGEEAHESDEESEYMIPSSRPVLPPITAPPAGETPSVPRPP
QPLAALQTQTLTLAEREDGSQMVDSMYNVQARSQQARDSDYSELPPLAMSNGTREEEKEE
ENCYDFPRPRLPMPTTRRTLSESSSSSSTAAFSHLSLDSDAGAAAPFSEPPEAPERPPKP
LPRRINSERRHSPVPPVPAPPAAAGGETNPQISWEIEHLLSEGYSYQDIQKALLIAQNNI
EMAKNILREFVSIPTAAHVLT
Download sequence
Identical sequences G3P2Y7
ENSGACP00000011960 ENSGACP00000011960 69293.ENSGACP00000011960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]