SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSGACP00000011993 from Gasterosteus aculeatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSGACP00000011993
Domain Number 1 Region: 29-178
Classification Level Classification E-value
Superfamily PH domain-like 7.5e-42
Family Phosphotyrosine-binding domain (PTB) 0.0008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSGACP00000011993   Gene: ENSGACG00000009088   Transcript: ENSGACT00000012017
Sequence length 276
Comment pep:known_by_projection group:BROADS1:groupX:13966894:13973125:1 gene:ENSGACG00000009088 transcript:ENSGACT00000012017 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDALRSAGRALVRSPGLAKQSWTAGRHRKLPENWTDTRETIVEGVTFNLRHLGMTLVERP
KGEELSAAAVKRIVATAKASGKKPPKVALKVSPQGIVLHDSATNQLLENVSIYRISYCTV
DALHDRVFAYIAQNALSGTLECHAFLCPKRKVAQAVALTVAQAFTLAFELWQVAKEEKGR
RAKSGSSGEAGSSSRSEKSDSLGSLRGTDVATDQLLDFGDGVNVESNGNVEGDQRPSETD
DNPPCETEDALDEAFSRLAVSRTNPQVLDIGVTPQD
Download sequence
Identical sequences G3P320
ENSGACP00000011993 ENSGACP00000011993 69293.ENSGACP00000011993

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]